KEGG   Neisseria lactamica: NLA_14530Help
Entry
NLA_14530         CDS       T01368                                 

Definition
(GenBank) putative uroporphyrinogen-III synthase HemD
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nla  Neisseria lactamica
Pathway
nla00860  Porphyrin and chlorophyll metabolism
nla01100  Metabolic pathways
nla01110  Biosynthesis of secondary metabolites
nla01120  Microbial metabolism in diverse environments
Module
nla_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NLA_14530
Enzymes [BR:nla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NLA_14530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CBN87668
UniProt: E4ZE83
Position
complement(1585868..1586623)
Genome map
AA seq 251 aa AA seqDB search
METAKPIMLIVRPSARAAEDVETCLNAGWRAEVLSPVEIEADAAGLELLSEQYARADAVF
WVSPTAIETAVPYLNLSDGIKIHIAVGQGSRRALERYLGRTVIAPDDGNDSEAVLRLPVW
DSLPEGARVLFVRGHGGRDFLMGRLREKGLQTELAEVYFRRHKPLNFQNFQAENITAAYI
TSAELARSLFAQLPPQFSRFFKSLLYFTHHPRIAEALKREGAEAVETVPSLEAALSHFRF
RRYDFPQTPNR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagcgaaacccattatgctgattgtccgtccgtccgccagggccgcagaagat
gtcgaaacctgcctgaatgctggttggcgcgcggaagtattgagtccggtcgaaatcgaa
gcagatgctgccggactggagcttttgtccgaacaatatgcccgcgccgatgcggtattt
tgggtcagtccgaccgcaatcgaaaccgccgtcccataccttaacctttcagacggcata
aagatacacattgccgtagggcagggcagccgccgcgcattggaacgctatttgggcaga
acggtcattgcgccggatgacggaaacgacagcgaggcggttttgcgcctgccggtttgg
gacagtctgcccgaaggtgcgcgcgtattgtttgtgcgcggacacggcgggcgcgatttc
cttatggggcggcttcgggaaaagggtttgcaaaccgaattggccgaagtgtatttcaga
cggcataaacctttgaactttcaaaatttccaagccgaaaatattactgccgcctatatt
acgtccgcagaactcgcgcgctcgctgtttgcacagcttccgccgcaattttcccgattc
ttcaaatccttgttatactttacccatcatccgcgcattgcggaggcattgaagcgcgaa
ggcgcggaggcggtggaaaccgtcccttcactggaagccgcgctgtcccatttccgtttc
agacggtatgactttccccaaacacccaatcgataa

DBGET integrated database retrieval system