KEGG   Neisseria lactamica: NLA_16290Help
Entry
NLA_16290         CDS       T01368                                 

Definition
(GenBank) putative zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nla  Neisseria lactamica
Pathway
nla00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NLA_16290
Enzymes [BR:nla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NLA_16290
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NLA_16290
    1.1.1.-  
     NLA_16290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 TrkA_N 2-Hacid_dh_C NAD_binding_2 3HCDH_N AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: CBN87834
UniProt: E4ZEP8
Position
1745778..1746842
Genome map
AA seq 354 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPAVAPGTVGINVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYIVHDDVPTGPGSNYHLSKDMNF
IGLGGCGGGLSEKIAVKRRWVHPISDKIPLDQAALIEPLSVGHHAYVRSGAKAGDVALVG
GAGPIGLLLAAVLKAKGIKVIITELSKARKDKAREAGVADYILDPSEVDVVAEVKKLTGG
EGVDVAFECTSVNKVLDTLVEACKPAANLVIVSIWSHPATINVHSVVMKELDVRGTIAYC
NDHAETIKLVEEGKINLEPFITQRIKLDELVSEGFERLIHNNESAVKIIVNPNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttttacgacaaaggcgatatccgcatcgaagacattcccgaaccg
gccgtagctccgggtactgtcggcatcaatgtcgcctggtgcggcatctgcggcaccgac
ctgcacgaatttatggaaggcccgattttcattccgccctgcggccatccgcatccgatt
tccggcgaatccgcacccgtcacgatgggacacgagttctccggcgtggtttatgccgtc
ggcgaaggcgtggacgacatcaaagtcggccaacacgttgtggttgaaccttacatcgta
cacgatgacgtaccgaccggtcctggcagcaactaccacctctccaaagacatgaacttt
atcggcttgggcggctgcggcggcggcctgtctgaaaaaatcgccgtcaaacgccgttgg
gtgcatccgatttccgacaaaatcccgttggatcaagccgctttgatcgagcctctgtcc
gtcggacaccacgcctatgtccgcagcggcgcaaaagcaggcgatgtcgcattggttggc
ggcgcaggcccgatcggtttgctgctggccgccgtgctgaaagccaaaggcatcaaagtc
atcattaccgagttgagtaaagcacgcaaagacaaagcgcgcgaagccggtgtggccgac
tacatcctcgatccgtccgaagtcgatgttgttgcagaagtgaaaaaactgaccggcggc
gaaggcgtggacgtggcatttgagtgtaccagcgtgaacaaagtgttggatactttggtc
gaagcctgcaaacctgccgccaacttggtcatcgtatccatctggagccaccccgccacc
atcaacgtccacagcgtcgtgatgaaagagctggacgtgcgcggcacgattgcctactgc
aacgaccacgccgaaaccatcaaactggtcgaagaaggcaaaatcaacctcgaacccttc
atcacccagcgcatcaagctggacgaactggtttccgaaggcttcgagcgtctgattcac
aacaacgaatccgccgttaaaattattgtgaatccaaacctgtaa

DBGET integrated database retrieval system