KEGG   Neisseria lactamica: NLA_6260Help
Entry
NLA_6260          CDS       T01368                                 

Definition
(GenBank) putative flavoprotein
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
nla  Neisseria lactamica
Pathway
nla00770  Pantothenate and CoA biosynthesis
nla01100  Metabolic pathways
Module
nla_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:nla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NLA_6260
Enzymes [BR:nla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     NLA_6260
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     NLA_6260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein DUF3568
Motif
Other DBs
NCBI-ProteinID: CBN86863
UniProt: E4ZBY6
Position
complement(625011..626219)
Genome map
AA seq 402 aa AA seqDB search
MGKHILLGVTGSIAAYKSCELVRLLKKQGHSVMVVMSRSATEFVSPLTFQALSGNPVLTD
THGGNGSNGMEHINLTRNADVFLIAPASMNTVAKICNGVADNLLTNLAAARKCPLAIAPA
MNVEMWLNPANQRNIAQLVSDGITVYMPGSGDQACGENGMGRMPEPAELLDLLPDLWTPK
ILKDKKILITAGATFEAIDPVRGITNISSGKMGVALARACRAAGAEVSLIHGQLQTALPF
GISDTVQAVSAEDMHRAVHRLIDKQDAFISVAAVSDYKVKNRSTQKFKKDKNAKPLSIEL
DENPDILASIASLPNPPFCIGFAAETENVLTYAREKRIKKKLPMIVANDVSIAMGKTTNQ
IVIIDDDAELSFPETSKDEAAMRIVERLAVCLNKYGTDEGSY
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaacatattcttttaggtgtaacgggcagtattgcggcgtataagtcttgcgag
ttggtgcggctgctgaaaaaacaggggcattcggttatggtggttatgagccgctcggca
actgaatttgtttctccgctgacttttcaggctttgagcggcaatcccgttctgaccgac
acgcacggcggcaacggttcaaacggtatggaacatatcaacttaacccggaatgcggat
gtttttctgattgcgccggcaagtatgaataccgtggcaaaaatctgtaacggcgtggca
gataacctactgaccaatctggcagccgcacggaaatgtcctcttgccatcgctcccgcg
atgaatgtggaaatgtggctcaaccctgccaaccaacggaatatcgcacaactggtttca
gacggcattactgtctatatgccgggctcgggcgaccaggcttgcggagaaaatggtatg
ggaaggatgccggaacccgcagaattgctggatctgcttccggatttatggacaccgaaa
attttaaaggacaagaaaatcttgattaccgcaggtgcgacatttgaagccattgaccct
gtcaggggcatcacaaatatttccagcgggaaaatgggcgtggctttggcgcgggcgtgc
cgtgccgccggtgcggaagtcagcctgattcacggacagcttcaaaccgcgctgcctttc
ggcatatccgatacagttcaagctgtcagtgccgaagatatgcatcgcgcagtgcatcgt
ttaatcgacaaacaagatgcttttatttctgttgccgccgtctcagactataaggttaaa
aacaggagtacgcaaaaattcaaaaaagataaaaatgccaaaccgttatccatcgaattg
gatgaaaaccctgatattttggcatccattgcctcattaccgaacccgccgttctgtatc
ggttttgccgctgaaacggagaatgtattgacatatgcacgagaaaaacgcattaagaaa
aagctaccgatgatcgttgccaatgatgtttcaatcgcaatgggcaagacaaccaaccaa
attgttatcatagatgatgatgcggagttatctttccccgaaacaagtaaagatgaagcg
gcaatgcggattgttgaaaggcttgccgtatgtttgaacaaatacgggacagatgagggc
agctactaa

DBGET integrated database retrieval system