KEGG   Nitrosospira lacus: EBAPG3_000230Help
Entry
EBAPG3_000230     CDS       T04907                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
nlc  Nitrosospira lacus
Brite
KEGG Orthology (KO) [BR:nlc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EBAPG3_000230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ARO86330
UniProt: A0A1W6SKK1
Position
53735..54118
Genome map
AA seq 127 aa AA seqDB search
MADSKKYEIIVTVHTTYLPEQSDEALDRYVFAYTISLANTGTVSAQLISRHWIIADGTGG
VQEVRGLGVVGEQPLLKPGDNFEYTSGTAISTPVGSMKGSYQMVAEDGLRFDATIPEFIL
SVPRVLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgatagtaaaaaatacgaaattattgtaacggttcacactacctacctcccggaa
cagtcggatgaagcgctcgaccgttacgtttttgcgtacaccatctcgcttgccaacaca
ggtacagtttcggcacagctcatcagccgccactggatcattgcggatgggactggcggt
gtgcaagaggtacggggcctgggagtggtcggtgagcagccgttgctaaaacccggagac
aatttcgaatatacaagtggtaccgccatttccacaccggttgggtcgatgaaaggtagc
tatcaaatggtggctgaagacggcctgcgcttcgatgcaaccatccctgaattcatcttg
agcgtgcccagggtattgcactaa

DBGET integrated database retrieval system