KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100580396
Entry
100580396         CDS       T03265                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00230  Purine metabolism
nle00240  Pyrimidine metabolism
nle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100580396 (DCK)
   00240 Pyrimidine metabolism
    100580396 (DCK)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100580396 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_33 AAA_28 CoaE
Other DBs
NCBI-GeneID: 100580396
NCBI-ProteinID: XP_003265766
Ensembl: ENSNLEG00000007725
UniProt: G1R861
Position
9
AA seq 260 aa
MATPPKRSCPSLSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCN
VQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKYESLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagagaagctgcccgtctctctcagccagctctgaggggacccgc
atcaagaaaatctccatcgaagggaacatcgctgcagggaagtcaacatttgtgaatatc
cttaaacaattgtgtgaagattgggaagtggttcctgaacctgttgccagatggtgcaat
gttcagagtactcaagatgaatttgaggaacttacaatgtctcagaaaaatggtgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccaaacatatgcc
tgtctcagtcgaataagagctcagcttgcctctctgaatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgaatgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaataaccaatttggccaaagccttgaattggatggaatcatttatcttcgagcc
actccagagaaatgcttacatagaatatatttacggggaagaaatgaagagcaaggcatt
cctcttgaatatttagagaagcttcattataaacatgaaagctggctcctgcataggaca
ctgaaaaccaacttcgattatcttcaagaggttcctatcttaacactggatgttaatgaa
gactttaaagacaaatatgaaagtctggttgaaaaggtcaaagaatttttgagtactttg
tga

DBGET integrated database retrieval system