KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100581013Help
Entry
100581013         CDS       T03265                                 

Gene name
NDUFS3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00190  Oxidative phosphorylation
nle01100  Metabolic pathways
nle04714  Thermogenesis
nle04723  Retrograde endocannabinoid signaling
nle04932  Non-alcoholic fatty liver disease (NAFLD)
nle05010  Alzheimer disease
nle05012  Parkinson disease
nle05016  Huntington disease
Module
nle_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100581013 (NDUFS3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100581013 (NDUFS3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100581013 (NDUFS3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100581013 (NDUFS3)
   05012 Parkinson disease
    100581013 (NDUFS3)
   05016 Huntington disease
    100581013 (NDUFS3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100581013 (NDUFS3)
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     100581013 (NDUFS3)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     100581013 (NDUFS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 100581013
NCBI-ProteinID: XP_003279027
Ensembl: ENSNLEG00000028559
UniProt: A0A2I3HIR7
Position
15
AA seq 266 aa AA seqDB search
MAAVAAAAARLWWRGIVGASALTRGAGRPSVLLLPLRRESAGADTRPTVRPRNDVAHKQL
SAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVD
VPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFF
ANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSP
WEAFPVYRQPPESLKLEAGNKKPEAK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggcggcggcggcagccaggctgtggtggcgcgggatcgtgggggcctcg
gcgctgaccagaggggctgggcgaccctcggttctgttgctgccgctgaggcgggagagc
gccggggccgacacgcgccccactgtcagaccacggaatgatgtggcccacaagcagctc
tcagcttttggagagtatgttgctgaaatcttgcccaagtatgtccaacaagttcaggtg
tcctgcttcaatgagttagaggtctgtatccatcctgatggcgtcatcccagtgctgact
ttcctcagggatcacaccaatgcacagttcaaatccctggttgacttgacagcagtggac
gtcccaactcggcagaaccgttttgagattgtctacaacctattgtctctgcgcttcaac
tcacggatccgtgtgaagacctacacagatgagctgacgcccattgagtctgctgtctct
gtgttcaaggcagccaactggtatgaaagggagatctgggacatgtttggagtcttcttt
gctaaccaccctgatctaagaaggatcctgacagattatggcttcgagggacatcctttc
cggaaagactttcctctatctggttatgttgagttacgttatgacgatgaggtgaagcgg
gtggtggcagagccggtggagttggcccaagagttccgcaaatttgacctgaacagcccc
tgggaggctttcccagtctatcgccaacccccggagagtctcaagcttgaagccggaaac
aagaagcctgaagccaagtag

DBGET integrated database retrieval system