KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100583585Help
Entry
100583585         CDS       T03265                                 

Gene name
ST3GAL6
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 6
  KO
K03792  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 10) [EC:2.4.99.6]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00601  Glycosphingolipid biosynthesis - lacto and neolacto series
nle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100583585 (ST3GAL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nle01003]
    100583585 (ST3GAL6)
Enzymes [BR:nle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     100583585 (ST3GAL6)
Glycosyltransferases [BR:nle01003]
 Terminal extension
  Sialyltransferase
   100583585 (ST3GAL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 100583585
NCBI-ProteinID: XP_003261767
UniProt: G1QPF9
Position
21
AA seq 331 aa AA seqDB search
MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQF
HPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVV
VGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHSDP
NTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYE
LLHFPKVFPKNQKPKHPTTGIIAITLAFYVCHEVHLAGFKYNFSDLKSPLHYYGNATMSL
MNKNAYHNVTAEQLFLKDIIEKNLVINLTQD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagagggtatcttgtggccatattcctgagtgctgtcttcctctattacgtactgcat
tgcatattatggggaacgaatgtctattgggtggcacctgtggaaatgaaacggagaaat
aagatccagccttgtttatcaaagccagcttttgcctctctgctgaggtttcatcagttt
cacccttttctgtgtgcagctgattttagaaagattgcttccttgtatggtagcgataag
tttgatttgccctatgggatgagaacgtcagcggaatattttcgacttgctctttcaaaa
ctgcagagttgtgatctctttgatgagtttgacaacataccctgtaaaaagtgtgtggtg
gttggtaatggaggagttttgaagaataagacattaggagaaaaaatcgactcctatgat
gtaataataagaatgaataatggtcctgttttaggacatgaagaagaagttgggagaagg
acaactttccgacttttttatccagaatctgttttttcagatcctattcacagtgaccct
aatacgacagtgattctcactgcttttaagccacatgatttaaggtggctgttggaattg
ttgatgggtgacaaaataaacactaatggtttttggaagaaaccagccttaaacctgatt
tataaaccttatcaaatccgaatattagatcctttcattatcagaacagcagcttatgaa
ctgcttcattttccaaaagtgtttcccaaaaatcagaaacctaaacacccaacaacagga
attattgccatcacattggcgttttacgtatgtcacgaagttcacctagctggttttaaa
tacaacttttctgacctcaagagtcctttgcactactatgggaatgccaccatgtctttg
atgaataagaacgcgtatcacaatgtgactgcagagcagctctttttgaaggacattata
gaaaaaaacctcgtaatcaatttgactcaagattga

DBGET integrated database retrieval system