KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100583943Help
Entry
100583943         CDS       T03265                                 

Gene name
HDC
Definition
(RefSeq) histidine decarboxylase isoform X1
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00340  Histidine metabolism
nle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    100583943 (HDC)
Enzymes [BR:nle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     100583943 (HDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 100583943
NCBI-ProteinID: XP_003266956
Ensembl: ENSNLEG00000006211
UniProt: G1R2Y0
Position
6
AA seq 662 aa AA seqDB search
MMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGD
IERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVM
DWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKSKILEMKTSEPDADESC
LNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVF
VCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFT
FNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSI
KLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNCLT
ENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQHCT
SQPSPRVGNLIPQITGARAWAGGTSLQSVSGAGDDPVQARKIIKQPQREGAGPIRRENGL
HLETLLDPVDDCFSEEAPDATKHKLSSFLFSYLSVQTKKKTVRSLSCNSVPVSAQKPLPT
EASVKNGGSSRVRLFSRFPEEMMMLKKSAFKKLIKFYSVPSFPECSSQCGLQLPCCPLQA
MV
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcctgaggagtacagagagagagggagagagatggtggattacatctgccag
tacctgagcactgtgcgggagagacgtgtgacgccagacgtgcagcctggctacctgcga
gcccagctgcctgagagtgctcctgaggaccccgacagctgggacagcatctttggggac
attgaacgaatcatcatgcctggggtggtacattggcagagcccccatatgcacgcctac
tacccagccctcacctcttggccctctctgctaggagacatgctggctgatgccatcaac
tgcttgggattcacttgggcgtccagccctgcgtgtacagagctggagatgaacgtcatg
gactggttggcaaaaatgctgggacttccagagcacttcttgcaccaccaccccagcagc
cagggcggaggcgtcctgcagagcacggtcagtgaatccactttgattgctctgctggca
gcaaggaagagcaaaatcctggaaatgaaaacgtctgagcccgatgctgatgagtcctgc
ctaaatgcccgactcgtggcctatgcctctgaccaggctcactcctctgtggaaaaggct
ggtttgatttcccttgtgaagatgaaatttctgcctgtggatgacaacttctcactccga
ggggaagctctccagaaggccatcgaggaagacaagcagcggggcttggtgcctgtcttt
gtctgtgcaacactagggaccactggggtctgtgcatttgactgcctgtcagagctgggc
cccatctgtgcccgtgaggggctgtggctccacatcgatgctgcttatgcaggcactgcc
ttcctgtgccccgagttccgggggtttctgaaggggattgagtatgccgactccttcacc
tttaatccttccaagtggatgatggtgcattttgactgtactgggttctgggtcaaggac
aagtacaagctgcagcagaccttcagtgtgaatcccatctacctcaggcatgccaactca
ggcgtggccaccgacttcatgcactggcagatccccctgagccgacggtttcgctctatt
aaactctggttcgtgattcggtccttcggggtgaagaatcttcaagcacatgtcagacat
ggtactgaaatggctaaatattttgaatctctggtcagaaatgacccttcctttgaaatt
cctgccaagaggcaccttggcctggtggtttttcgtctgaagggtcctaattgtctcaca
gaaaatgtgttaaaggaaatagctaaagctggccgtctcttcctcatcccggccactatc
caggacaagttaatcatccgttttactgtgacatcccagtttaccactagggatgacatc
ctgagagactggaatctcattcgagatgctgccactctcatcctgagtcagcactgtact
tcccaacccagccctcgggttgggaacctcatcccccaaatcacgggcgccagagcctgg
gctggtggaacgtcccttcagtctgtcagtggggcaggagatgatccagtccaggccagg
aagatcatcaagcagcctcagcgtgagggagccggtcccattagaagggaaaacggcctc
catcttgaaactctgctggacccagttgatgactgcttttcagaagaggccccggatgcc
accaagcacaagctgtcctccttcctgttcagttacttgtctgtgcagaccaagaagaag
acggtgcgctccctcagttgcaacagcgtgccagtgagtgctcagaagccactgcccaca
gaggcctctgtgaagaatgggggctcctccagggtcagactcttttccaggtttccagaa
gagatgatgatgctgaagaaaagtgccttcaaaaaactcatcaaattctacagcgtcccc
agctttcctgaatgcagctctcaatgtgggctccagctgccctgctgccctctgcaggcc
atggtttag

DBGET integrated database retrieval system