KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100585679Help
Entry
100585679         CDS       T03265                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1 isoform X1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04110  Cell cycle
nle04114  Oocyte meiosis
nle04115  p53 signaling pathway
nle04218  Cellular senescence
nle04540  Gap junction
nle04914  Progesterone-mediated oocyte maturation
nle05170  Human immunodeficiency virus 1 infection
nle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100585679 (CDK1)
   04114 Oocyte meiosis
    100585679 (CDK1)
   04115 p53 signaling pathway
    100585679 (CDK1)
   04218 Cellular senescence
    100585679 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100585679 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100585679 (CDK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100585679 (CDK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100585679 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100585679 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nle03032]
    100585679 (CDK1)
   03036 Chromosome and associated proteins [BR:nle03036]
    100585679 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100585679 (CDK1)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100585679 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100585679 (CDK1)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100585679 (CDK1)
DNA replication proteins [BR:nle03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100585679 (CDK1)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100585679 (CDK1)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100585679 (CDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Kdo Seadorna_VP7 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 100585679
NCBI-ProteinID: XP_003258286
Ensembl: ENSNLEG00000012138
UniProt: A0A2I3G9U5
Position
18
AA seq 297 aa AA seqDB search
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggaagattataccaaaatagagaaaattggagaaggtacctatggagttgtgtataaa
ggtagacacaaaactacaggtcaagtggtagccatgaaaaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatttctctattaaaagaacttcgtcat
ccaaatatagtcagtcttcaggatgtgcttatgcaggattccaggttatatctcatcttt
gagtttctttccatggatctgaagaaatacttggattctatccctcctggccagtacatg
gattcttcacttgttaagagttatttataccaaatcctacaggggattgtcttttgtcac
tctagaagagttcttcacagagacttaaaacctcaaaatctcttgattgatgacaaagga
acaattaaactggctgattttggccttgccagagcttttggaatacctattagagtatat
acacatgaagtagtaacactctggtacagatctccagaagtattgctggggtcagctcgt
tactcaactccagttgacatttggagtataggcaccatatttgctgaactagcaactaag
aaaccacttttccatggagattcagaaattgatcaactcttcaggattttcagagctttg
ggcactcccaataatgaagtgtggccagaagtggaatctttacaggactataagaataca
tttcccaaatggaaaccaggaagcctagcatcccatgtcaaaaacttggatgaaaatggc
ttggatttgctctcgaaaatgttaatctatgatccagccaaacgaatttctggcaaaatg
gcactgaatcatccatattttaatgatttggacaatcagattaagaagatgtag

DBGET integrated database retrieval system