KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100586590Help
Entry
100586590         CDS       T03265                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04022  cGMP-PKG signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04071  Sphingolipid signaling pathway
nle04270  Vascular smooth muscle contraction
nle04350  TGF-beta signaling pathway
nle04360  Axon guidance
nle04510  Focal adhesion
nle04530  Tight junction
nle04611  Platelet activation
nle04670  Leukocyte transendothelial migration
nle04810  Regulation of actin cytoskeleton
nle04921  Oxytocin signaling pathway
nle05132  Salmonella infection
nle05135  Yersinia infection
nle05163  Human cytomegalovirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100586590 (ROCK1)
   04071 Sphingolipid signaling pathway
    100586590 (ROCK1)
   04024 cAMP signaling pathway
    100586590 (ROCK1)
   04022 cGMP-PKG signaling pathway
    100586590 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100586590 (ROCK1)
   04530 Tight junction
    100586590 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100586590 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100586590 (ROCK1)
   04670 Leukocyte transendothelial migration
    100586590 (ROCK1)
   04062 Chemokine signaling pathway
    100586590 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100586590 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100586590 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    100586590 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100586590 (ROCK1)
   05206 MicroRNAs in cancer
    100586590 (ROCK1)
   05205 Proteoglycans in cancer
    100586590 (ROCK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100586590 (ROCK1)
   05135 Yersinia infection
    100586590 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100586590 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100586590 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100586590 (ROCK1)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100586590 (ROCK1)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100586590 (ROCK1)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100586590 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 HR1 Pkinase_C APH
Motif
Other DBs
NCBI-GeneID: 100586590
NCBI-ProteinID: XP_030666528
Ensembl: ENSNLEG00000006834
Position
4
AA seq 1354 aa AA seqDB search
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAMLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENE
ELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVNHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4065 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcgatttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcggattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaatcagagatttacgaatgaaagctgaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtatatgctatgaagcttctcagcaagtttgaaatgattaagagatctgattctgctttt
ttctgggaagaaagggacatcatggcttttgccaacagtccttgggttgttcagcttttt
tatgcattccaagatgatcgttatctctacatggtgatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcacgattctatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcacagagatgtgaag
cctgataacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggcatggtacgatgtgatacagcggttggaacacctgattat
atttcccctgaagtattaaaatcccaaggtggtgatggttattatggaagagaatgtgac
tggtggtcggttggggtatttttatatgaaatgcttgtaggtgatacacctttttatgca
gattctttggttggaacttacagtaaaattatgaaccataaaaattcacttacctttcct
gatgataatgacatatcaaaagaagcaaaaaaccttatttgtgccttccttactgacagg
gaagtgaggttagggcgaaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gaccagtgggcttgggaaacgctccgagacactgtagcaccagttgtacccgatttaagt
agtgacattgatactagtaattttgatgacttggaagaagataaaggagaggaagaaaca
ttccctattcctaaagcttttgttggcaatcaactaccttttgtaggatttacatattat
agcaatcgtagatacttatcttcagcaaatcctaatgataacagaactagctccaatgca
gataaaagcttgcaggaaagtttgcaaaaaacaatctataagctggaagaacagctgcat
aatgaaatgcagttaaaagatgaaatggagcagaagtgcagaacctcaaacataaaacta
gacaagataatgaaagaattggatgaagagggaaatcaaagaagaaatctagaatctaca
gtgtctcagattgagaaggagaaaatgttgctacagcatagaattaatgagtaccaaaga
aaagccgaacaggaaaatgagaagagaagaaatgtagaaaatgaagtttctacattaaag
gatcagttggaagacttaaagaaagtcagtcagaattcacagcttgctaatgagaagctg
tcccagttacaaaagcagctagaagaagccaatgacttacttaggacagaatcggacaca
gctgtaagattgaggaagagtcacacagagatgagcaagtcaattagtcagttagagtcc
ctgaacagagagttgcaagagagaaatcgaattttagagaattctaagtcacaaacagac
aaagattattaccagctgcaagctatgttagaagctgaacgaagagacagaggtcatgat
tctgagatgatcggagaccttcaagctcgaattacatctttacaagaggaggtgaagcat
ctcaaacataatcttgaaaaagtggaaggagaaagaaaagaggctcaagacatgcttaat
cactcagaaaaggaaaagaataatttagagatagatttaaactacaaacttaaatcatta
caacaacggttagaacaagaggtaaatgaacacaaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaggcaaagtctgtggcaatgtgtgagatggaaaaaaagctg
aaagaagaaagagaagctcgagagaaggctgaaaatcgggttgttcagattgagaaacag
tgttctatgctagacgttgatctgaagcaatctcagcagaaactagaacatttgactgga
aataaagaaaggatggaggatgaagttaagaatctaaccctgcaactggagcaggaatca
aataagcggctgttgttacaaaatgaattgaagactcaagcatttgaggcagacaattta
aaaggtttagaaaagcagatgaaacaggaaataaatactttattggaagcaaagagatta
ttagaatttgagttagctcagcttacgaaacagtatagaggaaatgaaggacagatgcgg
gagctacaagatcagcttgaagctgagcaatatttctcgacactttataaaacccaggta
aaggaacttaaagaagaaattgaagaaaaaaacagagaaaatttaaagaaaatacaggaa
ctacaaaatgaaaaagaaactcttgctactcagttggatctagcagaaacaaaagctgag
tctgagcagttggcgcgaggccttctggaagaacagtattttgaattgacgcaagaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagatcacactgttagtcgg
cttgaagaagcaaacagcatgctaaccaaagatattgaaatattaagaagagagaatgaa
gagctaacagagaaaatgaagaaggcagaggaagaatataaactggagaaggaggaggag
atcagtaatcttaaggctgcctttgaaaagaatatcaacactgaacgaacccttaaaaca
caggctgttaacaagttggcagaaataatgaatcgaaaagattttaaaattgatagaaag
aaagctaatacacaagatttgagaaagaaagaaaaggaaaatcgaaagctacaactggaa
ctcaaccaagaaagagagaaattcaaccagatggtagtgaaacatcagaaggaactgaat
gacatgcaagcgcaattggtagaagaatgtgcacataggaatgagcttcagatgcagctg
gccagcaaagagagtgatattgagcaattgcgtgctaaacttttggacctttcggattct
acaagtgttgctagttttcctagtgctgatgaaactgatggaaacctcccagagtcaaga
attgaaggttggctttcagtaccaaatagaggaaatatcaaacgatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaaaattttgttctataatgatgaacaagataaggag
caatccaatccatctatggtattggacatagataaactgtttcacgttagacctgtaacc
caaggagatgtgtatagagctgaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaatgtagaaaagatgtagagatggaaccagtacaacaagctgaaaaa
actaatttccaaaatcacaaaggccatgagtttattcctacactctaccactttcctgcc
aattgtgatgcctgtgccaaacctctctggcatgtttttaaaccaccccctgccctggag
tgtcgaagatgccatgttaagtgccacagagatcacttagataagaaagaggacttaatt
tgtccatgtaaagtaagttatgatgtaacatcagcaagagatatgctgctgttagcatgt
tctcaggatgaacaaaaaaaatgggtaaatcatttagtaaagaaaatccctaagaatcca
ccatctggttttgttcgtgcttcccctcgaacgctttctacaagatccactgcaaatcag
tctttccggaaagtggtcaaaaatacatctggaaaaactagttaa

DBGET integrated database retrieval system