KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100586693Help
Entry
100586693         CDS       T03265                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00561  Glycerolipid metabolism
nle01100  Metabolic pathways
nle04714  Thermogenesis
nle04723  Retrograde endocannabinoid signaling
nle04923  Regulation of lipolysis in adipocytes
Module
nle_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100586693
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100586693
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100586693
  09159 Environmental adaptation
   04714 Thermogenesis
    100586693
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nle01002]
    100586693
Enzymes [BR:nle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100586693
Peptidases [BR:nle01002]
 Serine Peptidases
  Family S33
   100586693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 DLH Esterase BAAT_C
Motif
Other DBs
NCBI-GeneID: 100586693
NCBI-ProteinID: XP_012357617
Position
21
AA seq 207 aa AA seqDB search
MGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKDYSRILKHLMEKASRMLKFWIP
RPFWVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNA
VSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELP
EVTNSVFHEINMWVSQRTATAGTASPP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcgccatcgccattctcacggctgcagagaggccgggccactttgccggcatg
gtactcatttcgcctctggttcttgccaatcctgaatctgcaacaactttcaaggattat
tcgaggattttgaaacacttgatggaaaaggcatcaagaatgttaaagttttggattcca
cgtcctttttgggtccttgctgcgaaagtgctcaaccttgtgctgccaaacttgtccctt
gggcccatcgactccagcgtgctctctcggaataagacagaggtcgacatttataactca
gaccccctgatctgccgggcagggctaaaggtgtgcttcggcatccagctgctgaatgct
gtctcgcgggtggagcgcgccctccccaagctgactgtgcccttcctgctgctccagggc
tctgccgatcgcctgtgtgacagcaaaggggcctacctgctcatggagttagccaagagc
caggacaagactctcaagatttatgaaggtgcctaccatgttctccacaaggagcttcct
gaagtcaccaactccgtcttccatgaaataaacatgtgggtctctcaaaggacagccact
gcaggaactgcgtccccaccctga

DBGET integrated database retrieval system