KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100586940Help
Entry
100586940         CDS       T03265                                 

Gene name
ETV6
Definition
(RefSeq) transcription factor ETV6
  KO
K03211  ETS translocation variant 6/7
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100586940 (ETV6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100586940 (ETV6)
Transcription factors [BR:nle03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100586940 (ETV6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT SAM_3
Motif
Other DBs
NCBI-GeneID: 100586940
NCBI-ProteinID: XP_012357946
Ensembl: ENSNLEG00000003450
UniProt: G1QTB4
Position
23
AA seq 452 aa AA seqDB search
MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIY
WSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHI
LKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH
RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPM
ENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILNPRHSVDFKQSRLSEDGLHRE
GKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRW
EDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM
KTPDEIMSGRTDRLEHLESQELDEQIYQEDEC
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagactcctgctcagtgtagcattaagcaggaacgaatttcatatacacctcca
gagagcccagtgccgagttacgcttcctcgacgccacttcatgttccagtgcctcgagct
ctcaggatggaggaagactcgatccgcctgcctgcgcacctgcgcttgcagccaatttac
tggagcagggatgacgtagcccagtggctcaagtgggctgaaaatgaattttctttaagg
ccaattgacagcaacacgtttgaaatgaatggcaaagctctcctgctgctgaccaaagag
gactttcgctatcgatctcctcattcaggtgatgtgctctatgaactccttcagcatatt
ctgaagcagaggaaacctcggattcttttttcaccattcttccaccctggaaactctata
cacacacagccggaggtcatactgcatcagaaccatgaagaagataactgtgtccagagg
acccccaggccatccgtggataatgtgcaccataaccctcccaccattgaactgttgcac
cgctccaggtcacctattacgacaaatcaccggccttctcctgaccccgagcagcggccc
ctccggtcccccctggacaacatgatccgccgcctctccccagctgagagagctcaggga
cccaggccgcaccaggagaacaaccaccaagagtcctaccctctgtcagtgtctcccatg
gagaataatcactgcccagcgtcctccgagtcccacccgaagccatccagcccccggcag
gagagcacacgcgtgatccagctgatgcccagccccatcatgcaccctctgatcctgaac
ccccggcactccgtggatttcaaacaatccaggctctctgaggacgggctgcatagggaa
gggaagcccatcaacctctctcatcgggaagacctggcttacatgaaccacatcatggtc
tctgtctccccccctgaagagcacgccatgcccattgggagaatagcagactgtagactg
ctttgggattacgtctatcagttgctttctgacagccggtacgaaaacttcatccgatgg
gaggacaaagaatccaaaatattccggatagtggatcccaacggactggctcgactgtgg
ggaaaccataagaacagaacaaacatgacctatgagaaaatgtccagagccctgcgccac
tactacaaactaaacattatcaggaaggagccaggacaaaggcttttgttcaggtttatg
aaaaccccagatgaaatcatgagtggccgaacagaccgtctggagcacctagagtcccag
gagctggatgaacaaatataccaagaagatgaatgctga

DBGET integrated database retrieval system