KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100587399Help
Entry
100587399         CDS       T03265                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I isoform X1
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04010  MAPK signaling pathway
nle04020  Calcium signaling pathway
nle04713  Circadian entrainment
nle04925  Aldosterone synthesis and secretion
nle04927  Cortisol synthesis and secretion
nle04929  GnRH secretion
nle04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100587399 (CACNA1I)
   04020 Calcium signaling pathway
    100587399 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100587399 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    100587399 (CACNA1I)
   04927 Cortisol synthesis and secretion
    100587399 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100587399 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100587399 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nle04040]
    100587399 (CACNA1I)
Ion channels [BR:nle04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100587399 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel DUF3043
Motif
Other DBs
NCBI-GeneID: 100587399
NCBI-ProteinID: XP_030671367
Position
7b
AA seq 2190 aa AA seqDB search
MAESASPPSSSAAAPAAEPGVTTEQPGPRSPPSSPPGLEEPLDGADPHVPHPDLAPVAFF
CLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDD
FIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTV
RVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCF
LEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDV
YDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWV
EIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYL
SSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPH
AKEPRHYKLCPQHSPLDVTAHTLVQPIPAMLASDPASCPCCQHEAGRRPSGLGSTDSGQE
GSGSGSSTGGEDEADGDEARSSEDRASSELGKEEEEEEEQADGAVWLCGDVWRETRAKLR
GIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAF
GLFDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVV
LMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTV
FQILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRS
YTDEDQSSSNMEEFDKLQEGLDSSGDPKLCPIPMTPNGHLDPSLPLGGHLGPAGAAGPAP
RLSLQPDPMLVALGSRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGRSAAWASRRSSWNSL
KHKPPSAEHESLLSAERGGGARACEVAADEGPPRAAPLHAPHTHHAHHGPHLAHRHRHHR
RTLSLDNRDSVDLAELVPAVGAHPRAAWRAAGPVPGHEDCNGRMPSIAKDVFTKMGDRGD
RGEDEEEIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDY
VVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQA
YLRSSWNVLDGFLVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKL
VVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANY
RWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISF
LLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYC
HTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEA
VLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIAR
VLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEG
MSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFV
LTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEMAHGLGPGPRLPAGSPGAPGR
GPGGAGGGGDTEGGLCRRCYSPAQENLWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSS
PAGCKKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGPKDSKGELDPP
EPMHVGDLGECFFPLSSTAVSPDPENFLCEMEEIPFNPVRSWLKHESSQAAPPSPFSPDA
SSPLLPMPAEFFHPAVSASQKGPEKGTGTGTLPKIALQGSWASLRSPRVNCTLLRQTTGS
DTSLDASPSSSAGSLQTTLEDSLTLSDSPRRALGPPALAPGPRAGLSPAARRRLSLRGRG
LFSLRGLRAHQRSHSSGGSTSPGCTHHDSMDPSDEEGRGGAGGGGAGSEHSETLRSLSLT
SLFCPPPPPPPPGLTPARKFSSTSSLAAPGRPRAAALAHGLARSPSWAADRSKDPPGRAP
MPMGLGPLAPPPQPLPGELEPGDAASKRKR
NT seq 6573 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagtgcctccccgccctcctcatctgcagcagccccagccgctgagccggga
gtcaccacggagcagcccggaccccggagccccccatcctccccgccaggcctggaggag
cccctggatggagctgatcctcatgtcccacacccagacctggcgcccgttgccttcttc
tgcctgcgacagaccaccagcccccggaactggtgtatcaagatggtgtgcaacccgtgg
tttgaatgtgtcagcatgctggtgatcctgctgaactgcgtgacacttggcatgtaccag
ccgtgcgacgacatggactgcctgtcggaccgctgcaagatcctgcaggtctttgatgac
ttcatctttatcttctttgccatggagatggtgctcaagatggtggccctggggattttt
ggcaagaagtgctacctcggggacacatggaaccgcctggatttcttcatcgtcatggca
gggatggttgaatactccctggaccttcagaacatcaacctgtcagccatccgcaccgtg
cgcgtcctgaggcccctcaaagccatcaaccgcgtgcccagtatgcggatcctggtgaat
ctactcctggacacgctgcccatgctggggaatgtcctgctgctctgcttctttgtcttc
ttcatctttggcatcataggcgtgcagctctgggcgggcctgctgcgtaaccgttgcttc
ctggaggagaacttcaccatacaaggggatgtggccttgcccccatactaccagccggag
gaggacgatgagatgcccttcatctgctccctgtcgggggacaatgggataatgggctgc
cacgagatccccccgctcaaggagcagggccgtgagtgctgcctgtccaaggacgacgtc
tacgactttggggcggggcgccaggacctcaatgccagcggcctctgtgtcaactggaac
cgttactacaatgtgtgccgcacgggcagcgccaacccccacaagggtgccatcaacttt
gacaacatcggttatgcttggattgtcatcttccaggtgatcactctggaaggctgggtg
gagatcatgtactacgtgatggatgctcactccttctacaacttcatctacttcatcctg
cttatcatagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccag
ttctcggagaccaagcaacgggagcaccggctgatgctggagcagcggcagcgctacctg
tcctccagcacggtggccagctacgccgagcccggcgactgctatgaggagatcttccag
tatgtctgccacatcctgcgcaaggccaagcgccgtgccctgggcctctaccaggccctg
cagagccggcgccaggccctgggcccggaggccccggcccccgccaaacctgggccccac
gccaaggagccccggcactacaagctgtgcccgcaacatagccccttggatgtgacggcc
cacaccctggtgcagcccatccccgccatgctggcctccgatcccgccagctgcccttgc
tgccagcatgaggctggccggcggccctcgggcctgggcagcaccgattcgggccaggag
ggctcgggctccgggagctccactggtggcgaggacgaggcggacggggacgaggcccgg
agcagcgaggacagagcctcctcggaactggggaaggaggaggaggaggaggaggagcag
gcggatggggcggtctggctgtgcggggatgtgtggcgggagacgcgagccaagctgcgc
ggcatcgtggacagcaagtacttcaaccggggcatcatgatggccatcctggtcaacacc
gtcagcatgggcatcgagcaccacgagcagccggaggagctgaccaacatcctggagatc
tgcaacgtggtcttcaccagcatgtttgctctggagatgatcctgaagctggctgcattt
gggctcttcgactacctgcggaacccctacaacatcttcgacagcatcattgtcatcatc
agcatctgggagatcgtggggcaggcggacggtgggctgtcagtgctgcggaccttccgg
ctgctgcgtgtgctgaaactggtgcgcttcatgcctgccctgcggcgccagctcgtggtg
ctcatgaagaccatggacaacgtggccaccttctgcatgctgctcatgctcttcatcttc
atcttcagcatccttgggatgcatatttttggctgcaagttcagcctccgcacggacact
ggagacacggtgcccgacaggaagaactttgactccctgctgtgggccattgtcaccgtg
ttccagatcctcacccaggaggactggaacgtcgttctctacaacggcatggcctccacc
tccccctgggcctccctctactttgtcgccctcatgacctttggcaactatgtgctcttc
aacctgctggtggccatcctggtggagggcttccaggcggagggtgacgccaatcgctcc
tacacggacgaggaccagagctcatccaacatggaggagtttgacaagctccaggaaggc
ctggacagcagcggagatcccaagctctgcccaatccccatgacccccaatgggcacctg
gaccccagtctcccactgggtgggcacctaggtcctgcaggggctgcgggacccgccccc
cgactctcactgcagccggaccccatgctggtggccctgggctcccgaaagagcagcgtc
atgtctctggggaggatgagctatgaccagcgctccctgtccagctcccggagctcctac
tacggaccatggggccgcagcgcggcctgggccagccgtcgctccagctggaacagcctc
aagcacaagccgccgtcggcggagcatgagtccctgctctctgcggagcgcggcggcggc
gcccgggcctgcgaggttgccgcggacgaggggccgccgcgggccgcacccctgcacgcc
ccacacacccaccacgctcatcacgggccccatctggcgcaccgccaccgtcaccaccgc
cggacgctgtccctcgacaacagggactcggtggacctggccgagctggtgcccgcggtg
ggcgcccacccccgggccgcttggagggcggcaggcccggtccccgggcatgaggactgc
aatggcaggatgcccagcatcgccaaggacgtcttcaccaagatgggcgaccgcggggat
cgcggggaggatgaggaggagatcgactacaccctgtgcttccgcgtccgcaagatgatc
gacgtctataagcccgactggtgcgaggtccgcgaagactggtctgtctacctcttctct
cccgagaacaggttccgggtcctgtgtcagaccattattgcccacaagctcttcgactac
gtcgtcctggccttcatctttctcaactgcatcaccatcgccctggagcggcctcagatc
gaggccggcagcaccgaacgcatctttctcaccgtgtccaactacatcttcacggccatc
ttcgtgggcgagatgacactgaaggtggtctcgctgggcctgtacttcggcgagcaggcg
tacctgcgcagcagctggaacgtgctggacggctttctcgtcttcgtgtccatcatcgac
atcgtggtgtccctggcctcggccgggggagccaagatcctgggggtcctccgagtcttg
cggctcctgcgcaccctacgccccctgcgtgtcatcagccgggcgccgggcctgaagctg
gtggtggagacactcatctcctccctcaagcccatcggcaacatcgtgctcatctgctgt
gccttcttcatcatctttggcatcctgggagtgcagctcttcaagggcaagttctaccac
tgtctgggcgtggacacccgcaacatcaccaaccgctcggactgcatggccgccaactac
cgctgggtccatcacaaatacaacttcgacaacctgggccaggctctgatgtccctcttt
gtcctggcatccaaggatggttgggtgaacatcatgtacaatggactggatgctgttgct
gtggaccagcagcccgtgaccaaccacaacccctggatgctgctgtacttcatctccttc
ctgctcatcgtcagcttctttgtgctcaacatgtttgtgggtgttgtggtggagaacttc
cacaagtgccggcagcaccaggaggctgaagaggcgcggcggcgtgaggagaagcggctg
cggcgcttggagaagaagcgccggaaggcccagcggctgccctactatgccacctattgt
cacacccggctgctcatccactccatgtgcaccagccattacctggacatcttcatcacc
ttcatcatctgcctcaacgtggtcaccatgtccctggagcactacaatcagcccacgtcc
ctggagacagccctcaagtactgcaactatatgttcaccactgtctttgtgctggaggct
gtgctgaagctggtggcatttggtctgaggcgcttcttcaaggaccgatggaaccagcta
gacctggccattgtgctactgtcagtcatgggcatcaccctggaggagatcgagatcaac
gcggccctgcccatcaaccccaccatcatccgcatcatgagggttctgcgcattgcccga
gtgctgaagctgttgaagatggccacagggatgcgggccctgctggacacggtggtgcaa
gctttgccccaggtgggcaacctgggcctcctcttcatgctgctcttcttcatctacgcc
gctctcggggtggagctcttcgggaagctggtctgcaacgacgagaacccatgcgagggc
atgagccggcatgccaccttcgagaacttcggcatggccttcctcacactcttccaggtc
tccacgggtgacaactggaacgggatcatgaaggacacgctgcgggactgcacccacgac
gagcgcagctgcctgagcagcctgcagtttgtgtcgccgctgtacttcgtgagcttcgtg
ctcaccgcgcagttcgtgctcatcaacgtggtggtggctgtgctcatgaagcacctggac
gacagcaacaaggaggcacaggaggacgccgagatggatgccgagctcgagctggagatg
gcccacggcctgggccctggcccgaggctgcctgccggctccccgggcgcccctggccga
gggccgggaggggcgggcggcgggggcgacaccgagggcggcttgtgccggcgctgctac
tcgcctgcccaggagaacctgtggctggacagcgtctctttaatcatcaaggactccttg
gagggggagctgaccatcatcgacaacctctcgggctccatcttccaccactactcctcg
cccgccggctgcaagaagtgtcaccatgacaagcaagaggtgcagctggctgagacggag
gccttctccctgaactcagacaggtcctcgtccatcctgctgggcgacgacctgagtctc
gaggaccccacggcctgcccacctggccccaaagacagcaagggtgagctggacccacct
gagcccatgcatgtgggagacctgggcgaatgcttcttccccttgtcctctacggctgtc
tcaccggatccagagaacttcctgtgtgagatggaggagatcccattcaaccctgtccgg
tcctggctgaaacatgagagcagtcaagcagcacccccaagtcccttctccccggacgcc
tccagccctctcctgcccatgccagccgagttcttccaccctgcagtgtctgccagccag
aaaggcccagaaaagggcaccggcactggaaccctccccaagattgcactgcagggctcc
tgggcatctctgcggtcaccaagggtcaactgtaccctcctccggcagaccaccgggagc
gacacgtcgctggacgccagccccagcagctccgcgggcagcctgcagaccacgctcgag
gacagcctgaccctgagcgacagccctcgacgcgccctggggccgcccgcgcttgctcca
ggaccccgggccggcctgtcccccgccgctcgccgccgcctgagcctgcggggccggggc
ctgttcagcctgcgggggctgcgggcgcatcagcgcagccacagtagcgggggctccacc
agcccgggctgcacccaccacgactccatggacccctcggacgaggagggccgcggcggc
gcgggcggcgggggcgcgggcagcgagcactcggagaccctccgcagcctctcgctcacc
tccctcttctgcccgccgcccccgccgccgccccccggcctcacgcccgccaggaagttc
agcagcaccagcagcctggccgcccccggccgcccccgcgccgccgccctggcccacggc
ctggcccggagcccctcgtgggccgcggaccgcagcaaggaccccccgggccgggcacca
atgcccatgggcctgggccccttggcgcccccgccgcaaccgctccccggagagctggag
ccgggagacgccgccagcaagaggaagagatga

DBGET integrated database retrieval system