KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100587969Help
Entry
100587969         CDS       T03265                                 

Gene name
PLA2G4C
Definition
(RefSeq) cytosolic phospholipase A2 gamma
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00564  Glycerophospholipid metabolism
nle00565  Ether lipid metabolism
nle00590  Arachidonic acid metabolism
nle00591  Linoleic acid metabolism
nle00592  alpha-Linolenic acid metabolism
nle01100  Metabolic pathways
nle04010  MAPK signaling pathway
nle04014  Ras signaling pathway
nle04072  Phospholipase D signaling pathway
nle04217  Necroptosis
nle04270  Vascular smooth muscle contraction
nle04370  VEGF signaling pathway
nle04611  Platelet activation
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04724  Glutamatergic synapse
nle04726  Serotonergic synapse
nle04730  Long-term depression
nle04750  Inflammatory mediator regulation of TRP channels
nle04912  GnRH signaling pathway
nle04913  Ovarian steroidogenesis
nle04921  Oxytocin signaling pathway
nle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100587969 (PLA2G4C)
   00565 Ether lipid metabolism
    100587969 (PLA2G4C)
   00590 Arachidonic acid metabolism
    100587969 (PLA2G4C)
   00591 Linoleic acid metabolism
    100587969 (PLA2G4C)
   00592 alpha-Linolenic acid metabolism
    100587969 (PLA2G4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100587969 (PLA2G4C)
   04010 MAPK signaling pathway
    100587969 (PLA2G4C)
   04370 VEGF signaling pathway
    100587969 (PLA2G4C)
   04072 Phospholipase D signaling pathway
    100587969 (PLA2G4C)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100587969 (PLA2G4C)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100587969 (PLA2G4C)
   04664 Fc epsilon RI signaling pathway
    100587969 (PLA2G4C)
   04666 Fc gamma R-mediated phagocytosis
    100587969 (PLA2G4C)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100587969 (PLA2G4C)
   04913 Ovarian steroidogenesis
    100587969 (PLA2G4C)
   04921 Oxytocin signaling pathway
    100587969 (PLA2G4C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100587969 (PLA2G4C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100587969 (PLA2G4C)
   04726 Serotonergic synapse
    100587969 (PLA2G4C)
   04730 Long-term depression
    100587969 (PLA2G4C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100587969 (PLA2G4C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100587969 (PLA2G4C)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100587969 (PLA2G4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B Patatin
Motif
Other DBs
NCBI-GeneID: 100587969
NCBI-ProteinID: XP_030677640
Ensembl: ENSNLEG00000004261
Position
10
AA seq 633 aa AA seqDB search
MAGVVGTDRDEPGSKRARPTRRRGLYKSAGAILPPGWPCSGPGGNTSSPRPPPTGRKGKQ
EDHRSFGTEDHRSLHPRRSRLKDLSRDYIAKRRRTENFLTTVHHGKKEEKAAVERRRFHV
LKALKKLRIEASEAPVVAVLCSGGGLRAHIACLGVLSEMKEQGLLDAVTYLAGVSGSTWA
ISSLYTNDGDIEALEADLKRRFTRQEWDLAKSLQKTIQAARSENYSLTDFWAYMVISKQT
RELPESHLSNMKEPVEEGTLPYPIFAAIDNDLQPSWQEARAPETWFEFTPHHAGFPALGS
RVSITNFGSKFKRGRLVRTHPERDLTSLRGLWRSALGNIEVIREYIFGAGQLRNPRTRQG
LWRRIVAHIRRIGNLFFAQSPRLEGSLPRKRLPPEDEFVEAEHTWLTEMLKDWTRTSLEE
QEQPHEDPERKGSLSNFLDFVKKTGICTSEWEWGTIHNFLYKHGGIRDKKMSSQKQLHLV
DAGLAINTPFPLVLPPMREVHLILSFDFSARDPFETIRATTDYCRRHKIPFPHVEEAELD
LRSKAPASCYILKGETGPVVMHFPLFNIDACEDNIEAWSDTYDTFKLTDTYTLDVVVPLL
ALAKENVRENKQKILTELMNVARLYYPRDNAQT
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgttgtgggcactgacagagatgagcctggcagcaagcgagcaaggcccaca
cgccgaagagggctgtataaaagcgcaggggccattttacctccaggttggccctgctca
ggaccaggaggaaacacctccagcccgcgacctcctcccacagggcgaaaaggaaagcag
gaggaccacagaagctttggcaccgaggatcaccgcagtcttcacccacggagatcccgg
ctgaaggatctgtccagggactacatcgctaagcgcaggaggactgagaattttctgacc
acagtgcaccatggaaagaaagaagaaaaggcggccgtggagagacgaagatttcatgtg
ctgaaagctctgaagaagctaaggatcgaggccagtgaggccccagttgttgctgtgctg
tgctcaggtggaggactgcgggctcacattgcctgccttggagtcctgagtgagatgaaa
gaacagggcctgttggatgccgtcacatacctcgcaggggtctctggatccacttgggca
atatcttctctctacaccaatgatggtgacatagaagctctcgaggctgacctgaaacgt
cgatttacccgacaggagtgggacttagctaagagcctacagaaaaccatccaagcagcg
aggtctgagaattactctctgaccgacttctgggcctacatggttatctccaagcaaacc
agagaactgccagagtctcatttgtccaatatgaaggagcctgtggaagagggaacacta
ccctacccgatatttgcagccattgacaacgacctgcaaccttcctggcaggaggcaaga
gcaccagagacctggttcgagttcacccctcaccacgctggcttccctgcactggggtcc
cgtgtttccataaccaacttcggaagcaaattcaagaggggaaggctggtcagaactcac
cctgagagagacctgacttccctgagaggtttatggagaagtgctcttggtaacattgaa
gtcattagggaatatatttttggtgcaggccagttaaggaatcctcggacccggcaaggt
ttatggagaaggattgttgctcatattagaaggattggaaaccttttttttgcccaatca
ccgaggctggaaggaagtttgccaaggaaacgtcttcccccagaagatgaattcgttgag
gctgaacacacctggctgactgagatgctcaaggattggaccaggacctccctggaagaa
caggagcagccccatgaggaccccgaaaggaaaggctcactcagtaactttctggatttt
gtgaaaaaaacaggcatttgcacttcagagtgggaatgggggaccattcacaacttcctg
tacaaacacggtggcatccgggacaagaaaatgagcagccagaagcaactccacctggtg
gatgctggtttagccatcaacactcccttcccactcgtgctgcccccaatgcgagaggtt
cacctcatcctctccttcgacttcagtgccagagatcctttcgagaccatccgggctacc
actgactattgccgccgccacaagattccctttccccacgtagaagaggctgagctggat
ttgcggtccaaggcccccgccagctgctacatcctgaaaggagaaactggaccagtggtg
atgcattttcccctgttcaacatagatgcctgtgaagataatattgaggcatggagtgac
acatatgacacattcaagctcacggacacctacactctagatgtggtggtgccactcttg
gcattagccaaggagaacgtcagggaaaacaagcagaagatccttacagagttgatgaac
gtggccaggctctactacccgagggataatgcccaaacttga

DBGET integrated database retrieval system