KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100589923Help
Entry
100589923         CDS       T03265                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit isoform X2
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04010  MAPK signaling pathway
nle04260  Cardiac muscle contraction
nle04261  Adrenergic signaling in cardiomyocytes
nle04921  Oxytocin signaling pathway
nle05410  Hypertrophic cardiomyopathy (HCM)
nle05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
nle05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100589923 (CACNG3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100589923 (CACNG3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100589923 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    100589923 (CACNG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100589923 (CACNG3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100589923 (CACNG3)
   05414 Dilated cardiomyopathy (DCM)
    100589923 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nle04040]
    100589923 (CACNG3)
Ion channels [BR:nle04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100589923 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 ABC2_membrane_2
Motif
Other DBs
NCBI-GeneID: 100589923
NCBI-ProteinID: XP_012360712
Ensembl: ENSNLEG00000011909
UniProt: G1RMK7
Position
2
AA seq 315 aa AA seqDB search
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggtatccagatgttgatcaccactgtgggagcctttgcagct
tttagtttaatgaccattgcagtgggcacggactactggttatattccagaggtgtgtgc
aggactaaatctacaagtgataatgaaaccagcaggaagaatgaagaagtaatgacccat
tcggggctgtggaggacctgctgcctagaaggggctttccgaggcgtgtgcaagaaaatc
gatcacttccctgaagatgctgactatgaacaggacacagccgagtatctcctgcgagct
gtgagggcctccagtgtcttccccatcctcagtgtcacgctgctgttcttcggcgggctc
tgcgtggcagccagtgagttccaccgcagcagacacaacgtcattctcagcgcgggcatc
ttttttgtctctgcagggttaagcaacatcattggcatcatagtttatatatcagccaac
gctggagaccccgggcagcgtgactccaaaaaaagttactcttatggttggtccttttat
ttcggagccttctctttcatcatcgcagaaattgtaggagtggttgccgtgcacatctat
attgaaaaacatcagcagttacgagccaaatcccactcggagttcctgaagaaatctact
tttgcccgcctcccaccctacaggtatcgattccggaggcggtcaagttctcgctccacc
gagcccagatcccgagacctgtcccccatcagcaaaggcttccacaccattccttccact
gacatctcgatgttcaccctctcccgggacccctcaaagatcaccatggggaccctcctc
aactccgaccgggaccacgcttttctacagttccacaattccacacccaaagagttcaaa
gagtcactgcataataatccggccaacaggcgcaccacgcccgtctga

DBGET integrated database retrieval system