KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100590282Help
Entry
100590282         CDS       T03265                                 

Definition
(RefSeq) selenide, water dikinase 1-like
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00450  Selenocompound metabolism
nle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100590282
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nle03016]
    100590282
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     100590282
Transfer RNA biogenesis [BR:nle03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    100590282
 Prokaryotic Type
    100590282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 100590282
NCBI-ProteinID: XP_003281726
Position
Un
AA seq 392 aa AA seqDB search
MSKRESFNPESYELDKSFRLTRFTELKGTGCRVPQDVLQKLLESLHENHFQEDEQFLGAV
TPRLGIGMDTCVIPLRHSGLSLVQTTDYIYPIVDDPYTMGRIACANVLSDLYAMGVTECD
NMLMLLGVSNKMTDRERDKVMPLIIQGFKDAAERAGTSVTGGQTVLNPWIVLGGVATTVC
QPSEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLLVLAKMA
AVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKG
NRTARIIDKPRIIEVAPQVATQNVNPTPGATS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcgggagtcctttaacccggaaagttacgaattggacaaaagcttccggcta
accagattcactgaactgaagggcacaggctgcagagtgccccaagatgtcctgcaaaaa
ttgctggaatctttacatgagaaccacttccaagaagatgagcagtttctgggagccgtt
acgccaaggctgggcattgggatggatacttgcgtcattcctttgaggcacagtgggctt
tccttggttcaaaccacagattacatttacccgatcgtagacgacccttacacgatgggc
aggatagcatgtgccaatgtcctcagtgacctctatgcaatgggggtcacggaatgtgac
aatatgctgatgctccttggagtcagtaataaaatgaccgacagggaaagggataaagtg
atgcctctgattatccaaggtttcaaagacgcagctgagagagcaggaacgtctgtaacg
ggcggccaaacagtactaaacccctggattgtcctgggaggagtcgctaccactgtctgc
cagcccagtgaatttatcatgccagacaatgcagtgccaggggacgtgctggtgttgaca
aaacccctggggacacaggtggcagtggctgtgcaccagtggctggatattcctgagaaa
tggaataagattaaactagtggtcacccaagaagatgtagagctggcctaccaggaggcg
atgatgaacatggcgaggctcaacaggacagctgcaggactcatgcacacgttcaatgcc
cacgccgccactgacatcacgggcttcgggattttgggccatgcgcagaacctggccaag
cagcagaggaacgaggtgtcgtttgtaattcacaacctcctggtgctggccaagatggct
gcggtgagcaaggcctgcggaaacatgttcggcctcatgcacgggacctgcccggagact
tcaggcggccttctgatctgtttaccacgtgagcaagcagctcggttctgtgcagagata
aagtcccccaaatatggtgaaggccaccaagcatggattattgggattgtagagaagggc
aatcgcacagccagaatcatagacaaaccccggatcatcgaggtcgcaccacaagtggct
actcaaaacgtgaatcccacacccggggccacctcctaa

DBGET integrated database retrieval system