KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100590927Help
Entry
100590927         CDS       T03265                                 

Gene name
ACOX3
Definition
(RefSeq) acyl-CoA oxidase 3, pristanoyl
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00071  Fatty acid degradation
nle00592  alpha-Linolenic acid metabolism
nle01040  Biosynthesis of unsaturated fatty acids
nle01100  Metabolic pathways
nle01212  Fatty acid metabolism
nle03320  PPAR signaling pathway
nle04024  cAMP signaling pathway
nle04146  Peroxisome
Module
nle_M00087  beta-Oxidation
nle_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100590927 (ACOX3)
   00592 alpha-Linolenic acid metabolism
    100590927 (ACOX3)
   01040 Biosynthesis of unsaturated fatty acids
    100590927 (ACOX3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100590927 (ACOX3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100590927 (ACOX3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100590927 (ACOX3)
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     100590927 (ACOX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 100590927
NCBI-ProteinID: XP_012355118
Position
20
AA seq 734 aa AA seqDB search
MDSGCMFCAGSHHAMASTVEGGDTALLPEFPRGPLDTYRARASFSWKELALFTEGEDTLR
FKKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSPLKVPAL
IQCLGMYDSSLAAKYLLHSLVFGSAVYSSGSERHLTYIQKIFRMEIFGCFALTELSHGSN
TKAIRTTAHYDPATEEFIIHSPDFEAAKFWVGNMGKTATHAVVFAKLHVPGDQCHGLHPF
IVQIRDPKTLLPMPGVMVGDIGKKLGQNGLDNGVPERRLAGTVPVWRVWRVAVQALRPQG
SGKPPAIWRTWAGAWQSSRELFPRQDVRQRFGASLGSLSSGRVSIVSLAVLNLKLAVAIA
LRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYLAAIYALDHFSKSLFLDLVELQRGLAS
GDRSARQAELGHEIHALASAGKPLASWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDP
NCTYEGDNNILLQQTSNYLLGLLAHRVQDGACFRSPLKSVDFLDAYPGILDQKFEVSSVA
DCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEARNKCQVSHGRPLALAFVELT
VVQRFHEHVHQPCVPPLLRAVLGRLSALYALWSLSRHAALLYRGGYFSGEQAGEVLESAV
LALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEF
SVNKPVIGGLKSKL
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggattcaggttgcatgttttgtgcaggctctcatcacgcgatggcgtccactgtggaa
ggaggtgacacagctctgctcccagaattccccagggggcccctcgacacctaccgagca
agagcgtccttcagctggaaggagctggcgctgttcacggaaggggaggacacgctccgc
tttaagaaaaccatcttctcagctcttgagaacgaccctctttttgcccgttcgcctgga
gccgatctgtccttggagaagtatcgcgagctgaacttccttcgatgcaagcggatcttc
gagtatgacttcctcagtgttgaagacatgttcaagagccctctgaaggtccccgccttg
attcagtgcctggggatgtatgactcttctctggctgccaaatacctcctccacagcttg
gtttttggatcagcagtttatagttctggttctgaaagacatctcacatatattcaaaag
atcttcaggatggagatttttggatgttttgctctgaccgaattaagccacggcagtaat
accaaggccattcgcacgactgcccactacgatcctgccactgaggaattcatcatacat
tcccctgatttcgaagctgccaagttttgggttggcaacatgggcaagacagccactcac
gcggtggtgtttgctaagctacacgtgccgggggaccagtgccatgggctgcatcccttt
atcgtgcagatccgggacccgaagacccttcttcccatgcctggagtgatggttggtgac
atagggaaaaaactcgggcagaacggtctggataacggggtgcctgagaggcgcttggca
gggacggtgcccgtgtggcgggtatggagggtcgctgttcaggcccttcgccctcagggc
agcgggaagcccccagccatctggaggacgtgggcaggggcctggcaaagcagccgagag
ctcttccctcgccaggacgtcaggcagcgctttggagcgtccttggggagcctgtcctcg
ggccgggtgtccatcgtgagcctggccgtccttaacctaaagctggccgtggccatcgct
cttcgcttctcagccactcggcgtcagtttggacccacagaggaggaggaaataccagtg
cttgagtatccaatgcagcaatggcgcttgcttccatatctggcagctatctacgcctta
gaccacttctccaagtcgctcttcctggacctggtggagctccagcgaggacttgcatcg
ggagaccgcagcgccagacaggcagagcttggacatgagatccacgctctggcatcggcc
ggcaagcccctggcctcgtggaccacccagcaaggaattcaggaatgccgggaggcgtgt
ggaggacacggctatctggccatgaaccggttgggtgtccttagagatgacaacgatccc
aactgcacatatgaaggtgacaacaacatcctgctgcagcagacaagcaactatttgctg
ggcctcctggcacaccgggtccaggatggagcttgcttccgcagtccgctgaagtcagtg
gactttctggacgcctatcccggcatccttgaccagaagtttgaggtctccagtgttgcc
gactgcttggactctgcagtcgccctggcagcatacaagtggctggtttgctacctgctc
cgagagacttatcaaaaattaaaccaagagaaaagatcaggaagcagtgactttgaagca
aggaacaaatgccaggtgtcccacggccgtccgttggcgctggccttcgtggagctcact
gtggtccagaggttccacgagcacgtgcaccagccctgcgtgccgcccttgctgcgggcc
gtgctggggcggctcagtgctctgtacgccctgtggtccctgagccgccacgcggccctg
ctctaccgaggaggatacttctccggtgagcaggcgggagaagtgttggagagcgccgtc
ctggccttgtgttcccagctgaaagacgacgcagttgccctggtagacgtgatcgctcct
cctgactttgttctggactcaccgattggcagagctgatggcgagctctacaaaaacctc
tggggcgctgtcctgcaggaaagcaaggtgttggagcgggcatcctggtggccagagttt
tctgtgaacaaacctgtcataggaggtctgaaatcgaagctgtag

DBGET integrated database retrieval system