KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100591401Help
Entry
100591401         CDS       T03265                                 

Gene name
HK3
Definition
(RefSeq) hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00010  Glycolysis / Gluconeogenesis
nle00051  Fructose and mannose metabolism
nle00052  Galactose metabolism
nle00500  Starch and sucrose metabolism
nle00520  Amino sugar and nucleotide sugar metabolism
nle00524  Neomycin, kanamycin and gentamicin biosynthesis
nle01100  Metabolic pathways
nle01200  Carbon metabolism
nle04066  HIF-1 signaling pathway
nle04910  Insulin signaling pathway
nle04930  Type II diabetes mellitus
nle04973  Carbohydrate digestion and absorption
nle05230  Central carbon metabolism in cancer
Module
nle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nle_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100591401 (HK3)
   00051 Fructose and mannose metabolism
    100591401 (HK3)
   00052 Galactose metabolism
    100591401 (HK3)
   00500 Starch and sucrose metabolism
    100591401 (HK3)
   00520 Amino sugar and nucleotide sugar metabolism
    100591401 (HK3)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100591401 (HK3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100591401 (HK3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100591401 (HK3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100591401 (HK3)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100591401 (HK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100591401 (HK3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100591401 (HK3)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100591401 (HK3)
Membrane trafficking [BR:nle04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100591401 (HK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF5473
Motif
Other DBs
NCBI-GeneID: 100591401
NCBI-ProteinID: XP_030664300
Ensembl: ENSNLEG00000012572
Position
Unknown
AA seq 1167 aa AA seqDB search
MREPCEDLSFPLLVSGHLVSEENRWQLQQELRREESDQLLCIPGGHPPLWKLMDSTGSSG
LWQGEEALSCPEEGLPGPSDSSGLFLLHVSLNVAATIRHTDDFSAKLMPEACSEPCLRSD
SGGWATVPAQPGLALRPAVISSLTSYPSLMTLLCRPPSALLAPSRTSAAQRIPFGFGGLH
RDTKFPMVLDPQLSTTGLILCSPSHDLRLKKDRPGQGGEVEWAWAPLACMAAGSTCCNAN
VAEEWAGQGRPLPWLELGSLASPAVLLPRCWPVSPQVQECLQQFKVTRAQLQQIQASLLG
SMEQALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGH
RVEPRSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPMNKQGLQLGFSFSFPCHQTGL
DRSTLISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRP
CEVGLVVDTGTNACYMEEARHVAVLDEDRGRVCVSVEWGSFSDDGALGPVLTTFDHTLDH
ESLNPGAQRFEKMIGGLYLGELVRLVLAHLARRGVLFGGCTSPALLSQGSILLEHVAEME
DPSAGAARVHAILQDLGLSPGASDVELVQHVCAAVCTRAAQLCAAALAAVLSCLQHSQEQ
QTLQVAVATGGRVCERHPRFCSVLQGTVMLLAPECDVSFIPSADGGGRGVAMVTAVAARL
AAHRRLLQETLAPFRLNHDQLAAVQAQMQKAMAKGLRGEASSLRMLPTFVRATPDGSERG
DFLALDLGGTNFRVLLVRVTTGVQITSQIYSIPESVAQGSGQQLFDHIVDCIVDFQQKQG
LSGQSLPLGFTFSFPCRQLGLDKGILLNWTKGFNASDCVGQDVVSLLREAIMRRRAVELN
VVAIVNDTVGTMMSCGYEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWG
AFGDDGSLAMLSTCFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRG
QQTQRLQTRDIFKTKFLSQIESDSLALRQVRAILEDLGLPLTSDDTLMVLEVCQAVSRRA
AQLCGAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPHFSSLVAATVRELAPRCAVTF
LQSEDGSGKGAALVTAVACRLAQLTRV
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaccttgtgaggacttgtccttccctttgttggtcagtggccatctggtgtct
gaagagaaccgctggcagctgcaacaagagctcagacgtgaggagagtgaccagcttctg
tgtatcccaggtggccaccctccactgtggaagctcatggactccactgggtcttcaggg
ttgtggcagggggaagaagccctgagttgccctgaggagggcttgcccgggccctcagac
agctcagggctgttcctcctgcatgtctccctcaacgtagccgctacaatcaggcacaca
gacgattttagtgccaaactcatgcctgaggcttgctcagaaccgtgcctcaggagtgac
agcggtggctgggccacagtgcctgcccagccaggactggctctaaggcctgccgtcatc
tcctccctcacttcttacccctccctgatgacactcctgtgcaggcccccatctgccctg
ctggctccatcacgtacatctgcagctcaaagaattcccttcggctttgggggacttcac
agggacaccaaatttcccatggtcctggacccccaactcagcaccacaggccttatcctg
tgctccccttcccatgaccttaggttgaaaaaagataggcctggtcaggggggcgaggta
gagtgggcatgggcacccctagcatgcatggctgctggaagcacgtgctgtaacgcaaac
gtagccgaggagtgggctgggcagggcaggcctctgccttggttggagttggggagtctg
gccagcccagcagtgctccttcccagatgttggcctgtttctccccaggtgcaggagtgc
ctgcagcagttcaaggtgacaagggcacagctacagcagatccaagccagcctcttgggt
tccatggagcaggctctgaggggacaggccagcccggcccctgcagtccggatgctgcct
acatacgtggggtccaccccacatggcactgagcaaggagacttcgtggtgctggagctg
ggggccacaggggcctcactgcgtgttttgtgggtgactctaactggcattgaggggcat
agggtggagcccagaagccaggagtttgtgatcccccaagaggtgatgctgggtgctggc
cagcagctctttgactttgctgcccactgcctgtctgagtttctggatgcgcagcctatg
aacaaacagggtctgcagcttggcttcagcttctctttcccttgccaccagacgggcttg
gacaggagcaccctcatttcctggaccaaaggttttaggtgcagtggtgtggaaggccag
gatgtggtccagctgctgagagacgccattcggaggcagggggcctacaacatcgacgtg
gttgctgtggtgaatgacacagtgggcaccatgatgggctgtgagccgggggtcaggccg
tgtgaggttgggctagttgtagacacgggcaccaatgcgtgttacatggaggaggcacgg
cacgtggcagtgctggacgaagaccggggccgcgtctgcgtcagcgtggagtggggctcc
ttcagcgatgatggggcgctgggaccagtgctgaccaccttcgaccacaccctggaccat
gagtccctgaatcctggtgctcagaggtttgagaagatgatcggaggcctgtatctgggt
gagctggtgcggctggtgctggctcacttggcccggcgtggggtcctctttggtggctgc
acctcccctgccctgctgagccaaggcagcatcctcctagaacacgtggctgagatggag
gacccctctgctggggcagcccgtgtccatgctatcctgcaggacttgggcctgagccct
ggggcttcggatgttgagcttgtgcagcacgtgtgtgcggccgtgtgcacgcgggctgcc
cagctctgtgctgccgccctggccgctgttctctcctgcctccagcacagccaggagcaa
caaacactccaggtcgctgtggccaccggaggccgagtgtgtgagcggcaccccagattc
tgcagcgtcctgcaggggacagtgatgctcctggccccggaatgcgatgtctccttcatc
ccctctgcggatggtggtggccgaggagtggcgatggtgaccgccgtggctgcccgtctg
gctgcccaccgtcgcctgctgcaggagaccctggccccgttccggttgaaccacgatcaa
ctggcagcagttcaggcacagatgcagaaggccatggccaaggggctccgaggggaggcc
tcctcccttcgcatgctgcccactttcgtccgggccacgcctgatggcagcgagcgaggg
gatttcctggccctggacctcgggggcacgaacttccgtgtcctcctggtacgtgtgacc
acaggtgtgcagatcaccagccagatctactccattcctgagagtgtggcccagggctct
gggcagcagctctttgaccacatcgtggactgcatcgtggacttccagcagaagcagggc
ctgagtgggcagagcctcccactgggttttaccttctccttcccatgtaggcagcttggc
ctggacaagggcatcctcctgaactggaccaagggtttcaacgcatcagactgcgtgggc
caagatgtcgtgagtctgttgcgggaagccatcatgcgcagacgggcagtggagctgaat
gtggttgccattgtcaatgacacggtggggaccatgatgtcctgtggctatgaggacccc
cgttgcgagataggcctcattgtcggaaccggcaccaatgcctgctacatggaggagctg
cggaatgtggcgggcgtgcctggggactcaggacgcatgtgcatcaacatggagtggggc
gcctttggggatgatggctctctggccatgctcagcacctgctttgatgcaagtgtggac
caggcgtccatcaaccccggcaagcagaggtttgaaaagatgatcagcggcatgtacctg
ggggagatcgtccgccacatccttttacatttaaccagccttggcgttctcttccggggc
cagcagacccagcgccttcagaccagggacatcttcaagaccaagttcctctctcagatc
gaaagtgacagcctggccctgcggcaggtccgagccatcctagaggatctggggctaccc
ctgacctcagacgacaccctgatggtgctagaggtgtgccaggccgtgtcccggcgggct
gcccagctctgtggggcgggtgtagctgccgtggtggagaagatccgggagaaccggggc
ctggaagagctggcagtgtctgtgggggtggatggaacgctctataagctgcacccgcac
ttctccagcctggtggcggccacggtgcgggagctggcccctcgctgtgcggtcacattc
ctgcagtcagaggatgggtccggcaaaggtgcagccctggtcaccgctgttgcctgccgc
ctcgcgcagctgactcgtgtctga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593006Help
Entry
100593006         CDS       T03265                                 

Gene name
HK2
Definition
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00010  Glycolysis / Gluconeogenesis
nle00051  Fructose and mannose metabolism
nle00052  Galactose metabolism
nle00500  Starch and sucrose metabolism
nle00520  Amino sugar and nucleotide sugar metabolism
nle00524  Neomycin, kanamycin and gentamicin biosynthesis
nle01100  Metabolic pathways
nle01200  Carbon metabolism
nle04066  HIF-1 signaling pathway
nle04910  Insulin signaling pathway
nle04930  Type II diabetes mellitus
nle04973  Carbohydrate digestion and absorption
nle05230  Central carbon metabolism in cancer
Module
nle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nle_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100593006 (HK2)
   00051 Fructose and mannose metabolism
    100593006 (HK2)
   00052 Galactose metabolism
    100593006 (HK2)
   00500 Starch and sucrose metabolism
    100593006 (HK2)
   00520 Amino sugar and nucleotide sugar metabolism
    100593006 (HK2)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100593006 (HK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100593006 (HK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100593006 (HK2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100593006 (HK2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100593006 (HK2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100593006 (HK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100593006 (HK2)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100593006 (HK2)
Membrane trafficking [BR:nle04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100593006 (HK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 100593006
NCBI-ProteinID: XP_003268759
Ensembl: ENSNLEG00000001062
UniProt: G1QK52
Position
14
AA seq 917 aa AA seqDB search
MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAA
VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
GSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV
EGRDVVTLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYME
EMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLG
LDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTVGVDGSVYKKH
PHFAKRLHKTVRRLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEPLQLS
HDQLLEVKRRMKIEMERGLCKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV
LLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPCQQNSLNESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVG
TMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDD
FRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG
IFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSITVKEVCTVVARRAAQLCGAGMAA
VVDKIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKG
AALITAVACRIREAGQR
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctcgcatctgcttgcctacttcttcacggagctcaaccatgaccaagtgcag
aaggttgaccagtatctctaccacatgcgcctctctgatgagaccctcttggagatctct
aagcggttccgcaaggagatggagaaagggcttggagccaccactcaccccactgcagca
gtgaagatgctgcccacctttgtgaggtccactccagatgggacagaacacggagagttc
ctggctctggaccttggagggaccaacttccgtgtgctttgggtgaaagtaacggacaat
gggctccagaaggtggagatggagaatcagatctatgccatccctgaggacatcatgcga
ggcagtggcacccagctgtttgaccacattgccgaatgcctggctaacttcatggataag
ctacaaatcaaagacaagaagctcccattgggttttaccttctcattcccctgccaccag
actaaactagatgagagtttcctggtctcatggaccaagggattcaagtccagtggagtg
gaaggcagagatgttgtgactctgatccggaaggccatccagaggagaggggactttgat
atcgacattgtggctgtggtgaatgacacagttgggaccatgatgacctgtggttatgat
gaccacaactgtgagattggtctcattgtgggcacgggcagcaacgcctgctacatggaa
gagatgcgccacatcgacatggtggaaggcgatgaggggcggatgtgtatcaatatggag
tggggggccttcggggacgatggctcgctcaatgacattcgcactgagtttgaccaggag
attgacatgggctcactgaacccggggaagcaactgtttgagaagatgatcagtgggatg
tacatgggggagctggtgaggcttatcctggtgaagatggccaaggaggagctgctcttt
ggggggaagctcagcccagagcttctcaacaccggtcgctttgagaccaaagacatctca
gacattgaaggggagaaggatggcatccggaaggcccgtgaggtcctgatgcggttgggc
ctggacccgactcaggaggactgcgtggccactcaccggatctgccagatcgtgtccaca
cgctctgccagcctgtgcgcagccaccctggccgccgtgctgcagcgcatcaaggagaac
aaaggcgaggagcggctgcgctctactgttggggtcgacggctccgtctacaagaaacac
ccccattttgccaagcgtctacataagactgtgcggcggctggtgcctgactgcgatgtc
cgcttcctccgctccgaagatggcagtggcaaaggtgcagccatggtgacagcagtggct
taccggctggccgatcaacaccgtgcccgccagaagacactagagcctctgcagctgagc
catgaccagctgttggaggtcaagaggaggatgaagatagaaatggagcgaggtctgtgc
aaggagactcatgccagtgcccccgtcaagatgctgcccacctatgtgtgtgccaccccc
gatggcacagagaaaggggacttcttggccttggaccttggaggaacaaatttccgggtc
ctgctggtccgtgttcggaatgggaagtggggtggagtggagatgcacaacaagatctac
gccatcccgcaggaggtcatgcacggtaccggggatgagctctttgaccacattgtccag
tgcatcgcggacttcctcgagtacatgggcatgaagggcgtgtccctgcctctgggtttt
accttctccttcccttgccagcagaacagcctgaacgagagcatcctcctcaagtggaca
aaaggcttcaaggcatctggctgcgagggcgaggatgtggtgaccctgctgaaggaagcg
atccaccggcgagaggagtttgacctggatgtggttgctgtggtgaacgacacagttgga
actatgatgacctgtggctttgaagaccctcactgtgaagttggcctcatcgttggcacg
ggcagcaatgcctgctacatggaggagatgcgcaatgtggaactggtggaaggagaagag
gggcggatgtgtgtgaacatggaatggggggccttcggggacaatggatgcctagatgac
ttccgcacagaatttgatgtggctgtggatgagctttcactcaaccctggcaagcagagg
ttcgagaaaatgatcagtggaatgtacctgggtgagattgtccgtaacattctcatcgat
ttcaccaagcgtgggctgctcttccgaggccgcatctcagagcggctcaagacaaggggc
atctttgaaaccaagttcttatctcagattgagagtgactgcctggccctgctgcaagtc
cgagccatcctgcaacacttagggcttgagagcacctgtgatgacagcatcactgttaag
gaggtgtgcaccgtggtggcccggcgggcagcccagctctgtggcgcaggcatggccgct
gtggtggacaagatacgagaaaaccgtgggctggatgctctcaaagtgacagtgggtgtg
gatgggaccctctacaagctacatcctcactttgccaaagtcatgcatgagacagtgaag
gacctggctccgaaatgtgatgtgtctttcctgcagtcagaggatggcagcgggaagggg
gcggcgctcatcactgctgtggcctgccgcatccgtgaggctggacagcgatag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100595352Help
Entry
100595352         CDS       T03265                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase HKDC1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00010  Glycolysis / Gluconeogenesis
nle00051  Fructose and mannose metabolism
nle00052  Galactose metabolism
nle00500  Starch and sucrose metabolism
nle00520  Amino sugar and nucleotide sugar metabolism
nle00524  Neomycin, kanamycin and gentamicin biosynthesis
nle01100  Metabolic pathways
nle01200  Carbon metabolism
nle04066  HIF-1 signaling pathway
nle04910  Insulin signaling pathway
nle04930  Type II diabetes mellitus
nle04973  Carbohydrate digestion and absorption
nle05230  Central carbon metabolism in cancer
Module
nle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nle_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100595352 (HKDC1)
   00051 Fructose and mannose metabolism
    100595352 (HKDC1)
   00052 Galactose metabolism
    100595352 (HKDC1)
   00500 Starch and sucrose metabolism
    100595352 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    100595352 (HKDC1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100595352 (HKDC1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100595352 (HKDC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100595352 (HKDC1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100595352 (HKDC1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100595352 (HKDC1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100595352 (HKDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100595352 (HKDC1)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100595352 (HKDC1)
Membrane trafficking [BR:nle04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100595352 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100595352
NCBI-ProteinID: XP_030653845
Ensembl: ENSNLEG00000026747
Position
18
AA seq 917 aa AA seqDB search
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMSRFRAEMEKGLAKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKNKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSHLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMGINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGMDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDRVLALFQLT
QEQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFT
FSFPCRQTSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGGEGMMCINTEWGGFGDNGCIDDI
RTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAQKEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtccacttgatggcattttacttcagcaagctgaaggaagatcagatcaag
aaggtggacaggttcctgtatcacatgcggctctccgatgacacccttttggacatcatg
agtcggttccgggctgagatggagaagggcctggcaaaggacaccaaccccacggctgca
gtgaagatgctgcccaccttcgtcagggccattcctgatggttccgaaaatggggagttc
ctttccctggatcttggagggtccaagttccgagtgctgaaggtgcaagtcgctgaagag
gggaagcgacacgtgcagatggagagtcagttctacccaacgcccaatgaaatcatccgt
gggaacggcacagagctgtttgaatatgtagctgactgtctggcagatttcatgaagaac
aaagatttaaagcataagaaattgccccttggcctaacattttcttttccctgccggcag
actaaactggaagagggtgtcctgctttcatggacaaagaagtttaaggcacgaggagtt
caggacacggatgtggtgagccatctgacgaaagccatgagaagacacaaggacatggac
gtggacatcctggccctggtcaatgacaccgtggggaccatgatgacctgtgcctatgac
gacccctactgcgaagttggtgtcatcatcggaactggcaccaatgcgtgttacatggag
gacatgagcaacattgacctggtggagggcgacgagggcaggatgggcatcaacacagag
tggggggccttcggggacgacggggccctggaggacattcgcactgagttcgacagggag
ctggacctcggctctctcaacccaggaaagcaactgtttgagaagatgatcagtggcctg
tacctgggggagcttgtcaggcttatcttgctgaagatggccaaggctggcctcctgttc
ggcggtgagaaatcttctgctctccacactaaaggcaagatcgaaacacggcacgtggct
gccatggagaagtataaagaaggccttgctaatacaagagagatcctggtggacctgggt
ctggaaccgtctgaggctgactgcattgccgtccagcatgtctgtaccattgtctccttc
cgctcggccaacctctgtgcagcagccctggcggccatcctgacacgcctccgggagaac
aagaaggtggaacggctccggaccacggtgggcatggacggcaccctctacaagatacac
cctcagtacccaaaacgcctgcacaaggtggtgaggaaactggtcccaagctgtgatgtc
cgcttcctcctgtcagagagtggcagcaccaagggggccgccatggtgactgcggtggcc
tcccgcgtgcaggcccagcggaagcagatcgacagggtgctggctttgttccagctgacc
caagagcagctcgtggacgtgcaggccaagatgcgggctgagctggagtatgggctgaag
aagaagagccacgggctggccacggtcaggatgctgcccacctatgtctgcgggctgccg
gacggcacagagaaaggaaagtttctcgccctggatcttgggggaaccaacttccgggtc
ctcctggtgaagatcagaagtggacggaggtcagtgcgaatgtacaacaagatcttcgcc
atccccctggagatcatgcagggcactggtgaggagctctttgatcacattgtacagtgc
atcgccgacttcctggactacatgggcctcaagggagcctccctacctttgggcttcaca
ttctcatttccctgcaggcagacgagcattgacaagggaacactcatagggtggaccaaa
ggtttcaaggccactgactgtgaaggggaggacgtggtggacatgctcagggaagccatc
aagaggagaaacgagtttgacctggacattgttgcagtcgtgaatgatacagtggggacc
atgatgacctgtggctatgaagatcctaattgtgagattggcctgattgcaggaacaggc
agcaacatgtgctacatggaggacatgaggaacatcgagatggtggaggggggtgaaggg
atgatgtgcatcaacacagagtggggaggatttggagacaatggctgcatagatgacatc
cggacccgatacgacacggaggtggacgaggggtccttgaatcctggcaagcagagatac
gagaaaatgaccagtgggatgtacttaggggagattgtgcggcagatcctgattgacctg
accaagcagggtctcctcttccgagggcagatttcagagcgtctccggaccaggggcatc
ttcgaaaccaagttcctgtcccagatcgaaagcgatcggctggccctcctccaggtcagg
aggattctgcagcagctgggcctggacagcacgtgtgaggacagcatcgtggtgaaagag
gtgtgcggagccgtgtcccggcgggcggcccagctctgcggtgctggcctggccgctata
gtggaaaaaaggagagaagaccaggggctggagcacctgaggatcactgtgggtgtggac
ggcaccctgtacaagctgcaccctcacttttctagaatattgcaggaaactgtgaaggaa
ctagcccctcgatgtgatgtgacattcatgctgtcggaagatggcagtggaaaaggggca
gcgctgatcactgctgtggccaagaggttacagcaggcacagaaggagaactag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100595917Help
Entry
100595917         CDS       T03265                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00010  Glycolysis / Gluconeogenesis
nle00051  Fructose and mannose metabolism
nle00052  Galactose metabolism
nle00500  Starch and sucrose metabolism
nle00520  Amino sugar and nucleotide sugar metabolism
nle00524  Neomycin, kanamycin and gentamicin biosynthesis
nle01100  Metabolic pathways
nle01200  Carbon metabolism
nle04066  HIF-1 signaling pathway
nle04910  Insulin signaling pathway
nle04930  Type II diabetes mellitus
nle04973  Carbohydrate digestion and absorption
nle05230  Central carbon metabolism in cancer
Module
nle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nle_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100595917 (HK1)
   00051 Fructose and mannose metabolism
    100595917 (HK1)
   00052 Galactose metabolism
    100595917 (HK1)
   00500 Starch and sucrose metabolism
    100595917 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100595917 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100595917 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100595917 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100595917 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100595917 (HK1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100595917 (HK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100595917 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100595917 (HK1)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100595917 (HK1)
Membrane trafficking [BR:nle04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100595917 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 100595917
NCBI-ProteinID: XP_030653463
Ensembl: ENSNLEG00000011439
Position
18
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTAI
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAAVKMLPSFVRRTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVTCISDFLDYMGIKGPRMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRTEASS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcacggagctgaaggatgaccaggtcaaa
aagattgacaagtatctctatgccatgcggctctccgatgaaactctcatagatatcatg
actcgcttcaggaaggagatgaagaatggcctctcccgggattttaatccaacagccata
gtcaagatgttgccaacattcgtaaggtcaattcctgatggctctgaaaagggagatttc
attgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaagtgaatcatgag
aaaaaccagaatgttcacatggagtccgaggtttatgacaccccagagaacatcgtgcac
ggcagtggaagccagctttttgatcatgttgctgagtgcctgggagatttcatggagaaa
aggaagatcaaggacaagaagttacctgtgggattcacgttttcttttccttgccaacaa
tccaaaatagatgaggccatcctgatcacctggacaaagcgatttaaagcgagcggagtg
gaaggagcagatgtggtcaagctgcttaacaaagccatcaaaaagcgaggggactatgat
gccaacatcgtagctgtggtgaatgacacagtgggcaccatgatgacctgtggctatgac
gaccagcagtgtgaagtcggcctgatcatcggcactggcaccaatgcttgctacatggag
gaactgaggcacattgatctggtggaaggagacgaggggaggatgtgtatcaacactgaa
tggggagcctttggagacgatggatcattagaagacatcaggacggagtttgacagggag
atagaccggggatccctcaaccctggaaaacagctgtttgagaagatggtcagtggcatg
tacttgggagagctggttcgactgatcctagtcaagatggccaaggagggcctcttattt
gaagggcggatcaccccggagctgctcaccagagggaagtttaacaccagtgatgtgtca
gccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccgtccgatgatgactgtgtctcggtccagcacgtttgcaccattgtctcattt
cgctcagccaacctggtggctgccacgctgggcgccatcttgaaccgcctgcgtgataac
aagggcacaccgaggctgcggaccacagttggtgtcgacggatctctttacaagacgcac
ccacagtattcccggcgtttccacaagactctgaggcgcttggtgccggactccgatgtg
cgcttcctcctctcggagagtggcagcggcaagggggctgccatggtgacggcggtggcc
taccgcttggccgagcagcaccggcagatagaggagaccctggctcatttccacctcacc
aaggacatgctgctggaggtgaagaagaggatgcgggccgagatggagctggggctgagg
aagcagacgcacaacaatgccgcggttaagatgctgccctccttcgtccggagaactccc
gacgggaccgagaatggtgacttcttggccctggatcttggaggaaccaatttccgtgtg
ctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcacaacaagatctat
gccattcctattgaaatcatgcagggcaccggggaagagctgtttgatcacattgtcacc
tgcatctctgacttcctggactacatggggatcaaaggccccaggatgcctctgggcttc
acgttctcatttccttgcaaacagacaagtctggacgcgggaatcttgatcacgtggaca
aagggttttaaggcaacagactgcgtgggccacgatgtagccaccttactaagggatgca
ataaaaaggagagaggaatttgacttggacgtggtggctgtggtcaacgacacagtgggc
accatgatgacctgtgcttatgaggagcccacctgtgaggtcggactcattgttgggacc
ggcagcaatgcctgctacatggaggagatgaagaacgtggagatggtggagggggaccag
gggcagatgtgcatcaacatggagtggggggcctttggggacaacgggtgtctggatgat
atcaggacacactacgacagactggtggacgaatattccctaaatgccgggaaacaaagg
tatgagaagatgatcagtggtatgtacctgggtgaaatcgtccgcaacatcttaatcgac
ttcaccaagaagggattcctcttccgagggcagatctctgagccgctgaagacccggggc
atctttgagaccaagtttctctctcagatcgagagtgaccgattagcactgctccaggtc
cgggctatcctccagcagctaggtctgaacagcacctgcgatgacagtatcctcgtcaag
acagtgtgcggggtggtgtccaggagggccgcgcagctgtgtggcgcaggcatggccgcg
gtggtggataagatccgcgagaacagaggactggaccgtctgaatgtgactgtgggagtg
gacgggacgctctacaagcttcatccacacttctccagaatcatgcaccagacggtgaag
gaactgtcaccaaaatgtaacgtgtccttcctcctgtctgaggatggcagcggcaagggg
gctgccctcatcacggccgtgggcgtgcggttacgcacagaggcaagcagctaa

DBGET integrated database retrieval system