KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100592713Help
Entry
100592713         CDS       T03265                                 

Gene name
MOK, RAGE
Definition
(RefSeq) MOK protein kinase
  KO
K08830  renal tumor antigen [EC:2.7.11.22]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100592713 (MOK)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100592713 (MOK)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   100592713 (MOK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo Dehydratase_SU
Motif
Other DBs
NCBI-GeneID: 100592713
NCBI-ProteinID: XP_003276267
Position
22a
AA seq 386 aa AA seqDB search
MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPH
PNILMLHEVVFDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIH
RNGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYT
YKMDLWSAGCVFYEIARSRAMNFDFPFKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERI
AAHQALQHPYFQEQRKTEKRALGSHRKAGFPAHPVAPEPLSHSCQVSKEGGKQKQSLKQE
EDHPKGQGPAYVMELPKLKLSGVVKLSSYSSPTLQSVLGSGTNGRVPVLRPLKCVPASKK
TDPRKDLKPAPQQCRLPTIVRKGGRY
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactataaagcaattggcaaaataggagagggaacgttttctgaagttatgaag
atgcaaagcctgagagatggaaactactatgcatgtaaacaaatgaagcagcgctttgaa
agtattgagcaagtcaacaacctacgagagatccaagcactgaggcgcctgaatccgcac
ccaaacattcttatgttgcatgaagtggtttttgacagaaaatctggttctcttgcacta
atatgtgaacttatggacatgaatatttatgagctaatacgagggagaagatacccatta
tcagaaaaaaaaattatgcactatatgtaccagttatgtaagtccctggatcatattcac
agaaatggaatatttcacagagatgtaaaaccagaaaatatactaataaagcaggatgtc
ctgaaattaggggactttggctcctgccggagtgtctattccaagcagccgtacacagaa
tacatctccacccgctggtaccgggccccggagtgtctcctcaccgacgggttctacacg
tacaagatggacctgtggagcgccggctgtgtgttctacgagatcgccaggtcgagagct
atgaattttgattttccttttaaaaagggatcaggaatacctctactgacaaccaatttg
tccccacaatgcctctccctcctgcacgcaatggtggcctatgatcccgatgagagaatc
gccgcccaccaggccttgcagcacccctacttccaagaacagaggaaaacagagaagcgg
gctctgggcagccacagaaaagctggctttccggcacaccctgtggcaccggagccactc
agtcacagctgccaggtttccaaggagggcggaaagcagaaacagtccctaaagcaagag
gaggaccatcccaagggacaaggaccagcctatgtcatggaactgcccaaactaaagctt
tcgggagtggtcaaactgtcgtcttactccagccccacgctgcagtccgtgcttggatcc
ggaacaaatggaagagtgccggtgctgagacccttgaagtgcgtccctgcgagcaagaag
acagatccgcggaaggaccttaagcctgctcctcagcagtgtcgcctgcccaccatagtg
cggaaaggcggaagatactga

DBGET integrated database retrieval system