KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100592796Help
Entry
100592796         CDS       T03265                                 

Gene name
CDK2
Definition
(RefSeq) cyclin dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04068  FoxO signaling pathway
nle04110  Cell cycle
nle04114  Oocyte meiosis
nle04115  p53 signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04218  Cellular senescence
nle04914  Progesterone-mediated oocyte maturation
nle04934  Cushing syndrome
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05169  Epstein-Barr virus infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05215  Prostate cancer
nle05222  Small cell lung cancer
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100592796 (CDK2)
   04151 PI3K-Akt signaling pathway
    100592796 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100592796 (CDK2)
   04114 Oocyte meiosis
    100592796 (CDK2)
   04115 p53 signaling pathway
    100592796 (CDK2)
   04218 Cellular senescence
    100592796 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100592796 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100592796 (CDK2)
   05203 Viral carcinogenesis
    100592796 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100592796 (CDK2)
   05215 Prostate cancer
    100592796 (CDK2)
   05222 Small cell lung cancer
    100592796 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100592796 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100592796 (CDK2)
   05162 Measles
    100592796 (CDK2)
   05161 Hepatitis B
    100592796 (CDK2)
   05160 Hepatitis C
    100592796 (CDK2)
   05169 Epstein-Barr virus infection
    100592796 (CDK2)
   05165 Human papillomavirus infection
    100592796 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100592796 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nle03032]
    100592796 (CDK2)
   03036 Chromosome and associated proteins [BR:nle03036]
    100592796 (CDK2)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100592796 (CDK2)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100592796 (CDK2)
DNA replication proteins [BR:nle03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100592796 (CDK2)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100592796 (CDK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 100592796
NCBI-ProteinID: XP_003252881
UniProt: G1S737
Position
11
AA seq 264 aa AA seqDB search
MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVTRRALFPGDSEIDQLFR
IFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKR
ISAKAALAHPFFQDVTKPVPHLRL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggagaacttccaaaaggtggaaaagatcggagagggcacatacggagttgtgtacaaa
gccagaaacaagttgacgggagaagtggtggcgcttaagaaaatccgcctggacactgag
actgagggtgtgcccagtactgccatccgagagatctctctgcttaaggagcttaaccat
cctaatattgtcaagctgctggatgtcattcacacagaaaataaactctacctggttttt
gaatttctgcaccaagatctcaagaaattcatggatgcctctgctctcactggcattcct
cttcccctcatcaagagctatctgttccagctgctccagggcctagctttctgccattct
catcgggtcctccaccgagaccttaaacctcagaatctgcttattaacacagagggggcc
atcaagctagcagactttggactagccagagcttttggagtccctgttcgtacttacacc
catgaggtgactcgccgggccctattccctggagattctgagattgaccagctcttccgg
atctttcggactctggggaccccagatgaggtggtgtggccaggagttacttctatgcct
gattacaagccaagtttccccaagtgggcccggcaagattttagtaaagttgtacctccc
ctggatgaagatggacggagcttgttatcgcaaatgctgcactacgaccctaacaagcgg
atctcggccaaggcagccctggctcaccctttcttccaggatgtgaccaagccagtaccc
catcttcgactctga

DBGET integrated database retrieval system