KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100594846
Entry
100594846         CDS       T03265                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:nle00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100594846 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nle04040]
    100594846 (ASIC1)
Ion channels [BR:nle04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   100594846 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 100594846
NCBI-ProteinID: XP_030672455
Ensembl: ENSNLEG00000029021
Position
8
AA seq 560 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVKPMQVAKELRRCTLPGTVFQGTQRARKGEKQVFTRYGKCYTFNSGRDGRPRLKT
MKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGF
QTFVACQEQRQLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMV
HMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAK
YLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASIL
TVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMT
YAANILPHHPARGTFEDFTC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggaactgaaggccgaggaggaggaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagcagctccacgctgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcactgtgggccctgtgcttcctgggctcgctggccgtgctgctgtgtgtg
tgcacggagcgtgtgcagtactacttccactaccaccatgtcaccaagctcgacgaggtg
gctgcctctcagcttaccttccctgctgtcacgctgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtatcatgccggggagctgctggccctgctcaacaac
aggtatgagataccagacacacagatggcagatgaaaagcagctggagatactgcaggac
aaagccaacttccgcagcttcaaacccaaacccttcaatatgcgtgagttctacgaccga
gccgggcacgacattcgagacatgctgctctcctgccacttccggggggaggtctgcagc
gccgaagacttcaaggtgaagcccatgcaggtggcaaaggagctcaggcgatgcactcta
ccaggaacagttttccagggcacacagagggcaagaaagggcgagaaacaggtcttcaca
cgctatggaaagtgctacacgttcaactcgggccgagatgggcggccgcggctgaagacc
atgaagggtgggacgggcaatgggctggaaatcatgctggacatccagcaggacgagtac
ctgcctgtgtggggggagactgatgagacgtccttcgaagcaggcatcaaagtgcagatc
catagtcaggatgaacctcctttcatcgaccagctgggctttggcgtggccccaggcttc
cagacctttgtggcctgccaggagcagcggcagctcatctacctgcccccgccctggggc
acctgcaaagctgtcaccatggactcggatttggatttcttcgactcctacagcattact
gcctgccgcatcgactgtgagacgcgctacctggtggagaactgcaactgccgcatggtg
cacatgccaggggatgccccatactgtactccagagcagtacaaggagtgtgcagatcct
gctctggacttcctggtggagaaggaccaggagtactgcgtgtgtgaaatgccttgcaac
ctgacccgctatggcaaggagctgtccatggtcaagatccccagcaaagcctcagccaag
tacctggccaagaagttcaacaaatctgagcaatacataggggagaacatcctggtgctg
gacattttctttgaagtcctcaactatgagaccattgaacagaagaaggcctatgagatt
gcagggctcctgggtgacatcgggggccagatggggctgttcatcggggccagcatcctc
acggtgctggagctctttgactacgcctacgaggtcattaagcacaagctgtgccgacga
ggaaaatgccagaaggaggccaaaaggagcagtgcggacaagggcgtggccctcagcctg
gacgacgtcaaaagacacaacccgtgcgagagcctccggggccaccctgccgggatgaca
tacgctgccaacatcctacctcaccatccggcccgaggcacgttcgaggactttacctgc
tga

DBGET integrated database retrieval system