KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100595111Help
Entry
100595111         CDS       T03265                                 

Gene name
CDK2AP1
Definition
(RefSeq) cyclin dependent kinase 2 associated protein 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
SSDB OrthologParalogGFIT
Motif
Pfam: CDK2AP DUF4248
Motif
Other DBs
NCBI-GeneID: 100595111
NCBI-ProteinID: XP_003276271
UniProt: G1QLD4
Position
10
AA seq 115 aa AA seqDB search
MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQ
SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacaaaccgaacttggccgcgcacatgcccgccgccgccctcaacgccgctggg
agtgtccactcgccttccaccagcatggcgacgtcttcacagtaccgccagctgctcagt
gactacgggccaccgtccctaggctacacccagggaactgggaacagccaggtgccccaa
agcaaatatgcggagctgctggccatcattgaagagctggggaaggagatcagacccacg
tatgcggggagcaagagtgccatggagaggctgaagcgcggcatcattcacgctagagga
ctggttcgggagtgcttggcagaaacggaacggaatgccagatcctag

DBGET integrated database retrieval system