KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100596451Help
Entry
100596451         CDS       T03265                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase-like
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nle01009]
    100596451
Enzymes [BR:nle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     100596451
Protein phosphatases and associated proteins [BR:nle01009]
 HAD phosphatases
  Other HAD phosphatases
   100596451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 HAD NiFe_hyd_3_EhaA
Motif
Other DBs
NCBI-GeneID: 100596451
NCBI-ProteinID: XP_004089978
Position
12
AA seq 227 aa AA seqDB search
MAAPPLVPAPQPVTHLIFDMDGLLLDTERLYSVVFQEICDRYDKKYSWDVKSLVLGKKAL
EAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKYGIPFALATSS
GSASFEMKTIRLFSHIVLGDDPEVPRGKPDPDIFLACAKRFSPCPAMEKCLVFEDAPNGV
EAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPPYE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccccgctggtgcccgcgccgcagcctgtcacccacctcatctttgacatg
gacggacttcttctggatactgaacggctgtattcagtggtatttcaagaaatatgtgat
cgctatgacaagaaatacagctgggatgtaaagtccctggttctgggtaagaaggcatta
gaggcggcacagattataatagacgtcttgcagctcccgatgtccaaagaggagctggta
gaagaaagccaaacgaagttaaaggaagtgttccccacagctgcgctcatgccaggggct
gagaaactcatcatccacctgcggaaatacggcatcccctttgcgctggccaccagctcg
gggtccgcgtcgttcgagatgaagacgatccgcttgttttcccacattgtgctgggagat
gaccccgaagtgccgcgtggcaagccagaccccgacatcttcctagcttgtgccaagagg
ttctctccctgtcctgctatggagaagtgccttgtctttgaagatgctcccaacggggtg
gaggcggccctggcagctgggatgcaggtggtcatggttcctgacggaaacttgagccga
gacctgacgacaaaggccaccctggtgctgaattccctgcaggacttccagcccgagctg
tttggtttgcccccctatgagtga

DBGET integrated database retrieval system