KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100596635Help
Entry
100596635         CDS       T03265                                 

Gene name
ZDHHC12
Definition
(RefSeq) zinc finger DHHC-type containing 12
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100596635 (ZDHHC12)
Enzymes [BR:nle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     100596635 (ZDHHC12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 100596635
NCBI-ProteinID: XP_003264264
Position
8
AA seq 276 aa AA seqDB search
MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTELRQWEEQGQLLLPLTFLLLVLGSLLL
YLAVSLMDPGYVNVQPQPQEALKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCV
RRYDHHCPWMDNCVGERNHPLFVVYLALHLVVLLWGLYLACTKPCPLHRKSGLRFFQPWG
LWLRSSGLLFATFLLLSLFSLVASLLLASHLYLVASNTTTWEFISSHRIAYLRQRPSNPF
DRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctgggcgctactcagccctggggtcctggtgcggaccgggcacaccgtgctg
acctggggaatcacgctggtgctgttcctgcacgataccgagctgcggcaatgggaggag
caggggcagctgctcctgcccctcaccttcctgctcctggtgctgggctccctgctgctc
taccttgctgtgtcactcatggaccctggctacgtgaatgtgcagccccagcctcaggag
gcgctcaaagaggagcagacagccatggttcctccagccatccctcttcggcgctgcaga
tactgcctggtgctgcagcccctgagagctcggcactgccgtgagtgccgccgttgtgtc
cgccgctacgaccaccactgcccctggatggataactgtgtgggagagcgcaaccaccca
ctctttgtggtctacctggcgctgcatctggtggtgcttctgtggggcctgtacctggca
tgcaccaagccctgtcccctgcaccgcaagtcaggcctccgcttcttccaaccctggggg
ctgtggctgcggtccagcgggctccttttcgccaccttcctgctgctgtccctcttctcg
ttggtggccagcctgctcctcgcctcgcacctctacctggtggccagcaacaccaccacc
tgggaattcatctcctcacaccgcatcgcctatctccgccagcgccccagcaaccccttc
gaccgaggcctgacccgcaacctggcccacttcttctgtggatggccctcggggtcctgg
gagaccctctgggctgaggaggaggaagagggcagcagcccagctgtttag

DBGET integrated database retrieval system