KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100596870Help
Entry
100596870         CDS       T03265                                 

Gene name
ATP1A1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04022  cGMP-PKG signaling pathway
nle04024  cAMP signaling pathway
nle04260  Cardiac muscle contraction
nle04261  Adrenergic signaling in cardiomyocytes
nle04911  Insulin secretion
nle04918  Thyroid hormone synthesis
nle04919  Thyroid hormone signaling pathway
nle04925  Aldosterone synthesis and secretion
nle04960  Aldosterone-regulated sodium reabsorption
nle04961  Endocrine and other factor-regulated calcium reabsorption
nle04964  Proximal tubule bicarbonate reclamation
nle04970  Salivary secretion
nle04971  Gastric acid secretion
nle04972  Pancreatic secretion
nle04973  Carbohydrate digestion and absorption
nle04974  Protein digestion and absorption
nle04976  Bile secretion
nle04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100596870 (ATP1A1)
   04022 cGMP-PKG signaling pathway
    100596870 (ATP1A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100596870 (ATP1A1)
   04918 Thyroid hormone synthesis
    100596870 (ATP1A1)
   04919 Thyroid hormone signaling pathway
    100596870 (ATP1A1)
   04925 Aldosterone synthesis and secretion
    100596870 (ATP1A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100596870 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    100596870 (ATP1A1)
  09154 Digestive system
   04970 Salivary secretion
    100596870 (ATP1A1)
   04971 Gastric acid secretion
    100596870 (ATP1A1)
   04972 Pancreatic secretion
    100596870 (ATP1A1)
   04976 Bile secretion
    100596870 (ATP1A1)
   04973 Carbohydrate digestion and absorption
    100596870 (ATP1A1)
   04974 Protein digestion and absorption
    100596870 (ATP1A1)
   04978 Mineral absorption
    100596870 (ATP1A1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100596870 (ATP1A1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100596870 (ATP1A1)
   04964 Proximal tubule bicarbonate reclamation
    100596870 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100596870 (ATP1A1)
Enzymes [BR:nle01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100596870 (ATP1A1)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100596870 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   100596870 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   100596870 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   100596870 (ATP1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 100596870
NCBI-ProteinID: XP_003268083
Ensembl: ENSNLEG00000005047
UniProt: A0A2I3GH95
Position
12
AA seq 1023 aa AA seqDB search
MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAA
TEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI
NAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR
NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAV
FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN
LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEI
PFNSTNKYQLSIHKNPNTSEPRHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQN
AYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVP
DAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDA
KACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVN
DSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL
TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPLHLLGLRVDWDDRWINDVED
SYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFE
ETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFLYDEVRKLIIRRRPGGWVEKE
TYY
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggggttggacgtgataagtatgagcccgcagctgtttcagaacaaggtgat
aaaaagggcaaaaagggcaaaaaagacagggacatggatgaactgaagaaagaagtttct
atggatgatcataaacttagccttgatgaacttcatcgtaaatatggaacagacttgagc
cggggattaacatctgctcgtgcagctgagatcctggcgcgagatggtcccaacgccctc
actccccctcccactactcctgaatggatcaagttttgtcggcagctctttgggggattc
tcaatgttactgtggattggagcgattctttgtttcttggcttatagcatccaagctgct
acagaagaggaacctcaaaatgataatctgtacctgggtgtggtgctatcagccgttgta
atcataactggatgcttctcctactatcaagaagctaaaagttcaaagatcatggaatcc
ttcaaaaacatggtccctcagcaagcccttgtgattcgaaatggtgagaaaatgagcata
aatgcagaggaggtcgtggttggggatctggtagaagtaaaaggaggggaccgaattcct
gctgacctcagaatcatatctgcaaatggctgcaaggtggataactcctcactcactggt
gaatcagaacctcagactaggtctccagatttcacaaatgaaaaccccctggagacgagg
aacattgccttcttttcaaccaattgtgttgaaggcaccgcacgtggtattgttgtctac
actggggatcgcactgtgatgggaagaattgccacacttgcttctgggctcgaaggaggc
cagacccccattgctgcagaaattgaacattttatccacatcatcacgggtgtggctgtg
ttcctgggtgtgtctttcttcatcctttccctcatccttgagtacacctggcttgaggct
gtcatcttcctcatcggtatcatcgtagccaatgtgccagaaggtttgctggccactgtc
acggtctgtctgacacttactgccaaacgcatggcgaggaaaaactgcttagtgaagaac
ttagaagctgtggagaccttggggtccacatccaccatctgctcagataaaactggaact
ctgactcagaaccggatgacagtggcccacatgtggtttgacaatcaaatccatgaagct
gatacgacagagaatcagagtggtgtctcttttgacaagacttcagctacctggcttgct
ctgtccagaattgcaggtctttgtaacagggcagtgtttcaggctaaccaggaaaaccta
cctattcttaagcgggcagttgcaggagatgcctctgagtcagcactcttaaagtgcata
gagctgtgctgtggttccgtgaaggagatgagagaaagatacgccaaaatcgtcgagata
cccttcaactccaccaacaagtaccagttgtccattcataagaaccccaacacgtcggag
ccccgacacctgttggtgatgaagggcgccccggaaaggatcctagaccgttgcagctct
atcctcctccacggcaaggagcagcccctggatgaggagctgaaagacgcctttcagaat
gcctatttggagctggggggcctcggagaacgagtcctaggtttctgccatctctttctg
ccagatgaacagtttcctgaagggttccagtttgacactgacgatgtgaatttccctatc
gataatctgtgctttgttgggctcatctccatgattgaccctccacgggcggccgttcct
gatgccgtgggcaaatgtcgaagtgctggaattaaggtcatcatggtcacaggagaccat
ccaatcacagctaaagctattgccaaaggtgtgggcatcatctcagaaggcaatgagacc
gtagaagacattgctgcccgcctcaacatcccagtcagccaggtgaaccccagggatgcc
aaggcctgcgtagtacatggcagtgatctaaaggacatgacctccgagcagctggatgac
attttgaagtaccacactgagattgtgtttgccaggacctcccctcagcagaagctcatc
attgtggaaggctgccagagacagggtgctatcgtggctgtgactggtgatggtgtgaat
gactctccagctttgaagaaagcagacattggggttgctatggggattgctggctcagat
gtgtccaagcaagctgctgacatgattcttttggatgacaactttgcctcaattgtgact
ggagtagaggaaggtcgtctgatctttgataacttgaagaaatccattgcttatacctta
accagtaacattcccgagatcaccccattcctgatatttattattgcaaacattccacta
ccactggggactgtcaccatcctctgcattgacttgggcactgacatggttcctgccatc
tccctggcttatgagcaggctgagagtgacatcatgaagagacagcccagaaatcccaaa
acagacaaacttgtgaatgagcggctgatcagcatggcctatgggcagattggtatgatc
caggccctgggcggcttctttacttattttgtgattctggctgagaacggcttcctcccg
cttcacctgttgggcctccgagtggactgggatgaccgctggatcaacgatgtggaagac
agctacgggcagcagtggacctatgagcagaggaaaatcgtggagttcacctgccacaca
gccttcttcgtcagtatcgtggtggtgcagtgggccgacttggtcatctgtaagaccagg
aggaattcggtcttccagcaggggatgaagaacaagatcttgatatttggcctctttgaa
gagacggccctggctgctttcctttcctactgccctggaatgggtgttgctcttaggatg
tatcccctcaaacctacctggtggttctgtgccttcccctactctcttctcatcttccta
tatgacgaagtcagaaaactcatcatcaggcgacgccctggaggctgggtggagaaggaa
acctactactag

DBGET integrated database retrieval system