KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100597533Help
Entry
100597533         CDS       T03265                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04010  MAPK signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04022  cGMP-PKG signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04072  Phospholipase D signaling pathway
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04520  Adherens junction
nle04910  Insulin signaling pathway
nle04913  Ovarian steroidogenesis
nle04923  Regulation of lipolysis in adipocytes
nle04930  Type II diabetes mellitus
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease (NAFLD)
nle04960  Aldosterone-regulated sodium reabsorption
Module
nle_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100597533 (INSR)
   04015 Rap1 signaling pathway
    100597533 (INSR)
   04010 MAPK signaling pathway
    100597533 (INSR)
   04066 HIF-1 signaling pathway
    100597533 (INSR)
   04068 FoxO signaling pathway
    100597533 (INSR)
   04072 Phospholipase D signaling pathway
    100597533 (INSR)
   04022 cGMP - PKG signaling pathway
    100597533 (INSR)
   04151 PI3K-Akt signaling pathway
    100597533 (INSR)
   04152 AMPK signaling pathway
    100597533 (INSR)
   04150 mTOR signaling pathway
    100597533 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100597533 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100597533 (INSR)
   04923 Regulation of lipolysis in adipocyte
    100597533 (INSR)
   04913 Ovarian Steroidogenesis
    100597533 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100597533 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100597533 (INSR)
   04213 Longevity regulating pathway - multiple species
    100597533 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100597533 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100597533 (INSR)
   04931 Insulin resistance
    100597533 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100597533 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:nle04090]
    100597533 (INSR)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100597533 (INSR)
Protein kinases [BR:nle01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100597533 (INSR)
CD molecules [BR:nle04090]
 Proteins
  100597533 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Furin-like Pkinase fn3
Motif
Other DBs
NCBI-GeneID: 100597533
NCBI-ProteinID: XP_012364810
Position
10
AA seq 1318 aa AA seqDB search
MGTLQRKLLIPAGCGVYRARDENTGPRFHVHEAGSAPDPANASTMRLLTCLASCSFSLLV
CPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVY
GLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCY
LATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSH
CQKVCPTICKSHGCTAEGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYH
FQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGP
CPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGY
LKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLF
FHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCKSLGNRLLLFCLESPYQNV
TEFDGQDACGSNSWTVVDIDPPLRSTDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDE
RRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQ
AEDSELFELDYCLKGECGQLCWDWSWFYFHRKTSSGTGAEDPRPSRKRRSLGDVGNVTAA
VPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEER
CSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGD
EELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSN
IAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVP
DEWEVPREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLN
EASVMKGFTCHHVVSPAGMGHGLAFLPLPSLCLLLLHRATEDTGCNLLPTPHSTKLPILE
PIFPLHFPMSTLRIHSYWIWPPPRACEPFVLSDFGMTRDIYETDYYRKGGKGLLPVRWMA
PESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPER
VTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDM
ENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS
NT seq 3957 nt NT seq  +upstreamnt  +downstreamnt
atgggtactttacagagaaagctactcatcccggctggctgcggagtttacagggcccgg
gatgaaaacacagggcccaggtttcatgtccatgaagccggctctgcccctgatcctgct
aatgcatccaccatgcgtctgcttacctgtcttgcttcctgttcattttctcttctagtg
tgtcccggcatggatatccggaacaacctcactaggttgcatgagctggagaattgctct
gtcatcgaaggacacttgcagatactcttgatgttcaaaacgaggcccgaagatttccga
gacctcagtttccccaaactcataatgatcactgattacttgctgctcttccgtgtctat
gggctcgagagcctgaaggacctgttccccaacctcacggtcatccggggatcacgactg
ttctttaactacgcgctggtcatcttcgagatggttcacctcaaggaactcggcctctac
aacctgatgaacatcacccggggttctgtccgcatcgagaagaacaatgagctctgttac
ttggccactatcgactggtcccgtatcctggattctgtggaggataattacatcgtattg
aacaaagatgacaacgaggagtgtggagacatctgtccgggtaccgcgaaaggcaaaacc
aactgcccagccaccgtcatcaacgggcagtttgtcgaacggtgttggactcatagtcac
tgccagaaagtttgcccgaccatctgtaagtcacatggctgcactgccgaaggcctctgt
tgccacagcgagtgcctgggcaactgttctgagcccgacgaccccaccaagtgcgtggcc
tgccgcaacttctacctggacggcagatgtgtggagacctgcccgcccccgtactaccac
ttccaggactggcgctgtgtgaacttcagcttctgccaggacctgcaccacaaatgcaag
aactcgcggaggcagggctgccaccagtacgtcattcacaacaacaagtgcatccctgag
tgtccctccgggtacacgatgaattccagcaacttgctgtgcaccccatgcctgggtccc
tgtcccaaggtgtgccacctcctagaaggcgagaagaccatcgactcggtgacgtctgcc
caggagctccgaggatgcaccgtcatcaacgggagtctgatcatcaacattcgaggaggc
aacaatctggcagctgagctagaagccaacctcggcctcattgaagaaatttcaggttat
ctaaaaatccgccgatcctacgctctggtgtcactttccttcttccggaagttacgtctg
attcgaggagagaccttggaaatcgggaactactccttctatgccttggacaaccagaac
ctaaggcagctctgggattggagcaaacacaacctcaccatcactcaggggaaactcttc
ttccactataaccccaaactctgcctgtcagaaatccacaagatggaagaagtttcagga
accaaggggcgccaggagagaaatgacattgccctgaagaccaatggggaccaggcatcc
tgtaagtcactgggtaaccgccttctgctgttttgtcttgaaagcccttatcagaatgtg
acggagttcgacgggcaggatgcgtgtggttccaacagctggacggtggtagacattgat
ccgcccctgaggtccaccgaccccaaatcacagaaccacccaggatggctgatgcggggt
ctcaagccctggacccagtatgccatctttgtgaagaccctggtcaccttttcggatgaa
cgccggacctatggggccaagagtgacatcatttatgtccagacagatgccaccaacccc
tctgtgcccctggatccaatctcagtgtctaactcatcatcccagattattctgaagtgg
aagcccccctcagaccccaatggcaacatcacccactacctggttttctgggagaggcag
gcggaagacagtgagctgttcgagctggattattgcctcaaaggtgagtgcgggcagctg
tgctgggattggagttggttttatttccacagaaaaacctcttcaggcactggtgccgag
gaccctaggccatctcggaaacgcaggtcccttggcgatgttgggaatgtgacggcagcc
gtgcccacggtggcagctttccccaacacttcctcaaccagcgtgcccacgagtccggag
gagcacaggccctttgagaaggtggtgaacaaggagtcactggtcatctccggcttgcga
cacttcacgggctatcgcatcgagctgcaggcttgcaaccaagacacccctgaggaacgg
tgcagtgtggcagcctacgtcagtgccaggaccatgcctgaagccaaggctgatgacatt
gtcggccctgtgacgcacgaaatctttgagaacaacgtcgtccacttgatgtggcaggag
ccgaaggaacccaatggtctgattgtgctgtatgaagtgagttatcggcgatatggcgat
gaggagctgcatctctgcgtctcccgcaagcacttcgctctggaacggggctgcaggctg
cgcgggctgtcgccggggaactacagcgtgcgagtccgggccacctccctcgcgggcaac
ggctcctggacagaacccacctatttctacgtgacagactatttagatgtcccgtcaaat
attgcaaaaattatcatcggccccctcatctttgtctttctcttcagtgttgtgattgga
agtatttatctattcctgagaaagaggcagccagatgggccgctgggaccactttacgct
tcttcaaatcccgagtatctcagtgccagtgatgtgtttccatgctctgtgtacgtgccg
gacgagtgggaggtgcctcgagagaagatcaccctccttcgagagctggggcagggctcc
tttggcatggtgtatgagggcaacgccagggacatcatcaagggtgaggcagagacccgc
gtggcagtgaagacggtcaacgagtcagccagtctccgagagcggattgagttcctcaat
gaggcctcggtcatgaagggcttcacctgccatcatgtggtgagtccagcggggatggga
catgggctggctttcttgccccttccctctctctgcctcctcctcctgcacagagcaaca
gaggacacagggtgtaacctcctacccaccccccactccactaagcttcccatcctagag
cccatcttcccccttcacttccccatgagtaccctcagaatccattcttactggatttgg
ccaccacccagagcgtgtgaaccttttgtgttgtcagactttggaatgaccagagacatc
tatgaaacggattactaccggaaagggggcaagggtctactccctgtacggtggatggcg
ccggagtccctgaaggatggggtctttaccacttcttctgacatgtggtcctttggcgtg
gtcctttgggaaatcaccagcttggcagaacagccttaccaaggcctgtcgaatgaacag
gtgttgaaatttgtcatggatggagggtatctggatcaacctgacaactgtccagagaga
gtcactgacctcatgcgcatgtgctggcaattcaaccccaagatgaggccaaccttcctg
gagattgtcaacctgctcaaggatgacctgcaccccagctttccggaggtgtcgttcttc
cacagcgaggagaacaaggctcccgagagtgaggagctggagatggagtttgaggacatg
gagaatgtgcccctggaccgttcctcacactgtcagagggaggaggcggggggccgggat
ggagggtcctcgctaggtttcaagcggagctacgaggaacacatcccttacacacacatg
aacggaggcaagaaaaacgggcggattctgaccttgcctcggtccaatccttcctaa

DBGET integrated database retrieval system