KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100598765Help
Entry
100598765         CDS       T03265                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00600  Sphingolipid metabolism
nle01100  Metabolic pathways
nle04020  Calcium signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04370  VEGF signaling pathway
nle04371  Apelin signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle05152  Tuberculosis
Module
nle_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100598765 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100598765 (SPHK1)
   04371 Apelin signaling pathway
    100598765 (SPHK1)
   04020 Calcium signaling pathway
    100598765 (SPHK1)
   04072 Phospholipase D signaling pathway
    100598765 (SPHK1)
   04071 Sphingolipid signaling pathway
    100598765 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100598765 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100598765 (SPHK1)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100598765 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100598765
NCBI-ProteinID: XP_003279154
Ensembl: ENSNLEG00000002302
Position
14
AA seq 384 aa AA seqDB search
MDPAGGPWGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERSDWETAIRKPLCSLPAGSGNALAASL
NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLRTASGLRLFSVLSLAWGFIADVDLE
SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP
LEEPVPSHWTVVPDQDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGRGVFAVDGELMVSEAVQGQVHPNYFW
MVSGCVDPPPSWKPQQTPPPEEPL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatccagcgggcggcccctggggcgtgctcccgcggccctgccgcgtgctggtgctg
ctgaacccgcgcggcggcaagggcaaggccctgcagctcttccggagtcacgtgcagccc
cttttggctgaggctgaaatctccttcacgctgatgctcactgagcggcggaaccatgcg
cgggagctggtgcggtcggaggagctgggccgctgggacgctctggtggtcatgtctgga
gacgggctgatgcacgaggtggtgaacgggctcatggagcggtctgactgggagaccgcc
atccggaagcccctgtgtagcctcccagcaggctctggcaacgcgctggcagcttccttg
aaccattatgctggctatgagcaggtcaccaatgaagacctcctgaccaactgcacgctg
ttgctgtgccgccggctactgtcacccatgaacctgctgtctctgcgcacggcttcgggg
ctgcgcctcttctctgtgctcagcctggcctggggcttcattgctgatgtggacctagag
agtgagaagtatcggcgtctgggggagatgcgcttcactctgggcaccttcctgcgtctg
gcagccctgcgcacctaccgcggccgactggcctacctccctgtaggaagagtcggctct
aagacacctgcctcccccgttgtggtccagcagggccccgtagatgcacaccttgtgcca
ctggaggagccagtgccctctcactggacagtggtgcctgaccaggactttgtactagtc
ctggcgctgctgcactcacacctgggcagtgagatgtttgctgcacccatgggccgctgt
gcagctggtgtcatgcatctgttctacgtgcgagccggagtgtctcgggccatgctgctg
cgcctcttcctggccatggagaagggcaggcatatggagtatgaatgcccctacttggta
tatgtccccgtggtcgccttccgcttggagcccaaggatgggagaggtgtgtttgcagtg
gatggggaattgatggttagcgaggccgtgcagggccaggtgcacccaaactacttctgg
atggtcagtggttgcgtggatcccccacccagctggaagccccagcagacgccacctcca
gaagagcccttatga

DBGET integrated database retrieval system