KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100599249
Entry
100599249         CDS       T03265                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nle01009]
    100599249 (AKAP5)
Protein phosphatases and associated proteins [BR:nle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     100599249 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 100599249
NCBI-ProteinID: XP_003267856
Ensembl: ENSNLEG00000019133
UniProt: G1SBT7
Position
1a
AA seq 427 aa
METTVSEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVAR
KCPQEAGASDQPEPPRGAWASLKRLVTRRKRSESSKQQKPLEAEMQPAINAEDADLSKKK
AKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSITSGEKVISVELGLDNGHSAVQTGTLILEETETIKEKQ
DVQPQQASPPETAETDHQQPVLSDVPPLPAIPDQQIVEEASNSILESAPNGKDYESREIV
AEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVKKSKNVPK
QILISTENEQVGVFANDNGFQDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
KINNLLQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccacagtttcagaaattcatgtagaaaacaaggatgagaagagatcagcagaa
ggtagtcctggggctgaaaggcagaaggaaaaggcatccatgctttgcttcaagagaaga
aagaaagcagctaaagcactgaagcccaaagctggctctgaagctgctgatgtggcaagg
aagtgtccgcaagaagcaggagcttctgatcagccagagcccccacggggggcctgggcc
tcactcaaacgtcttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagcca
ttggaggctgaaatgcaacctgcaataaatgctgaggatgctgatctttctaagaaaaag
gcaaaatctagacttaagattccctgcataaaattcccaagagggccaaaaaggagtaat
cattccaaaattatagaagactcagactgcagcatcaaagtccaggaagaagctgaaatt
ttggatatacaaacacagaccccattgaatgatcaggcaacaaaggctaagtcaacccag
gatctaagtgaaggtatctcacggaaagatggtgatgaagtctgtgaatcaaatgtgagc
aatagcataacttctggagagaaagtgatttcagtagaacttggattagataacgggcat
tctgctgttcaaacaggaactctaatccttgaagaaactgaaacgatcaaggaaaaacaa
gatgttcaaccccagcaagcaagcccacctgaaactgcagaaacagaccatcagcaacca
gtactttctgatgttcctcctttacctgcaatcccagatcaacaaattgtggaagaagcc
agtaacagtatcctagaaagtgcaccaaatgggaaagactatgaaagtagagagattgta
gctgaagaaactaaaccaaaagatactgaattgagccaagaatcagattttaaagaaaat
gggatcactgaagagaaatccaaatcagaagaaagcaaaagaatggagccaattgctatt
attattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccctaag
caaatcttaatttcaactgaaaatgagcaagtaggggtttttgctaatgataatggtttt
caggatagaacttcagaacaatatgaaacactcttaattgaaacagcctcttctctcgtc
aagaatgctattcaattgtcaatagaacagctggttaatgaaatggcctctgatgataat
aaaataaacaatcttctacagtga

DBGET integrated database retrieval system