KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100599327Help
Entry
100599327         CDS       T03265                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X2
  KO
K17890  autophagy-related protein 16-1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04136  Autophagy - other
nle04140  Autophagy - animal
nle04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:nle00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100599327 (ATG16L1)
   04136 Autophagy - other
    100599327 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100599327 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100599327 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:nle03029]
    100599327 (ATG16L1)
Membrane trafficking [BR:nle04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    100599327 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    100599327 (ATG16L1)
Mitochondrial biogenesis [BR:nle03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100599327 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 SGL SH3_2 TolB_like
Motif
Other DBs
NCBI-GeneID: 100599327
NCBI-ProteinID: XP_012359568
Ensembl: ENSNLEG00000008221
Position
22a
AA seq 607 aa AA seqDB search
MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEK
HDIPNRHEISPGHDGTWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRK
DREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
HPGSGKEVRVPTTALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKG
SLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSES
IVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSDWTRV
VFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPAGSHVVSVDKGCK
AVLWAQY
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggcctccgcgccgctgacttcccccgctggaagcgccacatctcggagcaa
ctgaggcgccgggaccggctgcagagacaggcgttcgaagagatcattttgcagtataac
aaattgctggaaaagtcagatcttcattcagtgttggcccagaaactacaggctgaaaag
catgacataccaaacaggcatgagataagtcccggacatgatggcacgtggaatgacagt
cagctacaagaaatggcccaactgaggattaagcaccaagaggaactgactgaattacac
aagaaacgtggggagttagctcaattggtgattgacctgaataaccaaatgcagcggaag
gacagggagatgcagatgaatgaagcaaaaattgcagaatgtttgcagactatctctgac
ctggagacggagtgcctagacctgcgcactaagctttgtgaccttgaaagagccaaccag
accctgaaggatgaatatgatgccctgcagatcacctttactgccttggagggaaaactg
aggaaaactacggaagagaaccaggagctggtcaccagatggatggctgagaaagcccag
gaagccaatcggcttaacgcagagaatgaaaaagactccaggaggcggcaagcccggctg
cagaaagaacttgcagaagcagcaaaggaacctctaccagtcgaacaggatgatgacatt
gaggtcattgtggatgaaacctctgatcacacagaagagacctctcctgtgcgagccatc
agcagagcagccactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttgggagacgctctgtctcttccttcccagtcccccaggacaatgtggatact
catcctggttctggtaaagaagtgagggtaccaaccactgccttgtgtgtcttcgatgca
catgatggggaagtcaacgctgtgcagttcagtccaggttcccggttactggccaccgga
ggcatggaccgcagggtgaagctttgggaagtatttggagaaaaatgtgagttcaagggt
tccctatctggcagtaatgcaggaattacaagcattgaatttgatagcgctggatcttac
ctcttagcagcttcaaatgattttgcaagccgaatctggactgtggatgattatcggtta
cggcacacactcacgggacacagtgggaaagtgctgtctgctaagttcctgctggacaat
gcgcggattgtctcaggaagtcacgaccggactctcaaactctgggatctacgcagcaaa
gtctgcataaagacagtgtttgcaggatccagttgcaatgatattgtctgcacagagcaa
tgtgtaatgagtggacattttgacaagaaaattcgtttctgggacattcgatcagagagc
atagttcgagagatggagctgttgggaaagattactgccctggacttaaacccagaaagg
actgagctcctgagctgctcccgggatgacttgctaaaagttatcgatctccgaacaaat
gctgtcaagcagacattcagtgcacctgggttcaagtgcggctctgactggaccagagtt
gtcttcagccctgatggcagttacgtggcggcaggctctgctgagggctctctctatatc
tggagtgtgctcacagggaaagtggaaaaggttctttcaaagcagcacagctcatccatc
aatgcggtggcgtggtcgcccgctggctcgcacgttgttagtgtggacaaaggatgcaaa
gctgtgctgtgggcacagtattga

DBGET integrated database retrieval system