KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100600085Help
Entry
100600085         CDS       T03265                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis protein 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100600085 (DOCK8)
Membrane trafficking [BR:nle04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100600085 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 100600085
NCBI-ProteinID: XP_030671469
Ensembl: ENSNLEG00000008451
Position
1a
AA seq 2099 aa AA seqDB search
MATLPSAERRAFALKINRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVE
PVDFEGLLMTHLNSLDVQLAQELGDFTDDDLDVVFTPKECRTLQPSLPEEGVELDPHVRD
CVQTYIREWLIVNRKNQGSPEICGFKKTGSRKDFHKTLPKQTFESETLECSEPAAQAGPR
HLNVLCDVTGKGPVTACDFDLRSLQPDKRLENLLQQVSAEDFEKQNEEARRTNRQAELFA
LYPSVDEEDAVEIRPVPECPKEHLGNRILVKLLTLKFEIEIEPLFASIALYDVKERKKIS
ENFHCDLNSDQFKGFLRAHTPSVAASSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIGD
CAEPYMIIKESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLSSFFNVSTLERE
VTDVDSVVGRSSVGERRTLAQSRRLSERALSLEENGVGSNFKTSTLSVSSFFKQEGDRLS
DEDLFKFLADYKRSSSLQRRVKSIPGLLRLEISTAPEIINGCLTPEMLPMKPFPENRTRP
HKEILEFPTREVYVPHTVYRNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPV
IFGKSNGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGA
SVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKG
VFNIEVQAVSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISETALEHELKLSIICL
NSSRLEPLVLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKD
QHGRNCLLASYVHYVFRLPEVQRDVPKSGAPTAIPDPRSYHTYGRTSAAAVSSKLLQARV
MSSSNPDLAGTHSAADEEVKNIMSSKIAERNCSRMSYYCSGNSDVPGSTAAPRPASKKHF
HEELALQMVVSTGMVRETVFKYAWFFFELLVKSMAQHVHNMDKRDSFRRTRFSDRFMDDV
TTIVNVVTSEIAALLVKAQKENEQAEKMNISLAFFLYDLLSLMDRGFVFNLIRHYCNQLS
AKLNNLPTLISMRLEFLRILCSHEHYLNLNLFFMNADAAPTSPCPSISSQNSSSCSSFQD
QKIASMFDLTSEYRQQHFLTGLLFTELAAALDAEAEGISKVQRKAVSAIHSLLSSHDLDP
RCVKPEVKVKIAAFYLPLVGIILDALPQLCDFTVADTRRYRTSGSDEEQEGAGAINQNVA
LAIAGNNFNLKTSGIVLSSLPYKQYNMLNADTTRNLMICFLWIMKNADQSLIRKWIADLP
SMQLNRILDLLFICVLCFEYKGKQSSDKVSTQALQKSRDVKARLEEALLRGEGARGEMMR
RRAPGNDRFPGLNENLRWKKEQTHWRQANEKLDKTKAELDQEALISGNLATEAHLIILDM
QENIIQASSALDCKDSLLGGVLRVLVNSLNCDQSTTYLTHCFATLRALIAKFGDLLFEEE
VEQCFDLCHQVLHHCSSSMDVTRSQACATLYLLMRFSFGATSNFARVKMQVTMSLASLVG
RAPDFNEEHLRRSLRTILAYSEEDTAMQMTPFPTQVEELLCNLNSILYDTVKMREFQEDP
EMLMDLMYRIAKSYQASPDLRLTWLQNMAEKHTKKKCYTEAAMCLVHAAALVAEYLSMLE
DHSYLPVGSVSFQNISSNVLEESVVSDDTLSPDEDGVCAGQYFTESGLVGLLEQAAELFS
TGGLYETVNEVYKLVIPILEAHREFRKLTLTHSKLQRAFDSIVNKDHKRMFGTYFRVGFF
GSKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAEFVEVIKDSTPVDKTKLDPNK
AYIQITFVEPYFDEYEMKDRITYFEKNFDLRRFMYTTPFTLEGRPRGELHEQYRRNTVLT
TMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDPKMLQMVLQGS
VGATVNQGPLEVAQVFLAEIPADPKLYRYHNKLRLCFKEFIMRCGEAVEKNKRLITADQR
EYQQELRKNYNKLKENLRPMIERKIPELYKPIFRVESQKRDSFHRSSFRKCETQLSQGS
NT seq 6300 nt NT seq  +upstreamnt  +downstreamnt
atggccactctgcccagcgcagagcgccgcgcgttcgcgctcaagatcaacaggtattct
tcagcggaaataaggaaacagtttactctcccaccaaaccttggccagtaccatcgacag
agcataagtacctctggcttcccctctcttcaactacctcagttttatgaccctgtggag
ccagtggactttgaaggacttctgatgacacacctgaatagcctggatgtgcagcttgcc
caggagctcggggacttcactgatgacgacttggacgtggtgttcacgccaaaggaatgt
aggactttgcagccctctttgccggaggaaggggttgaactggaccctcatgtcagggat
tgtgttcagacctacatccgggagtggctaatcgtgaaccggaaaaaccaaggaagtcca
gaaatttgtggctttaaaaagactggatcccgaaaagattttcacaagacgcttccgaaa
cagacgtttgagtcggaaaccctggagtgcagtgaacccgctgctcaggcaggcccccgc
cacttaaatgtgctgtgcgatgtgactgggaaaggccccgtcactgcctgtgactttgac
ctccgcagcctgcagcctgacaagcggctagaaaacctcctgcagcaagtgagtgccgag
gactttgagaagcagaatgaggaggcccggaggaccaatcggcaggccgagctctttgcc
ctttacccatcagtggatgaggaggatgctgtggaaatacgtccagtaccagaatgtccc
aaggaacacctgggcaacagaatattggtcaagttgctgaccttgaagttcgagattgaa
attgagcctctgtttgccagcattgccctctatgatgttaaagaaaggaaaaagatctcg
gaaaattttcactgtgacctgaactctgaccagttcaaaggatttctgcgagctcacacg
ccttcagtggccgcatcaagtcaggcgagatctgcagtcttctcggtcacctacccgtcc
tcagacatctacctggtagtcaagattgaaaaagtcctgcagcagggagagattggagac
tgtgcagagccctacatgattatcaaagaaagtgacggtggaaagagtaaagaaaagatt
gaaaaactaaaactccaagctgaatccttctgccagcgtttggggaagtaccggatgccc
tttgcctgggcacccataagcttatcaagcttcttcaatgtctccacccttgagagggag
gtaactgatgtggactctgtggttgggagaagctcagtgggtgaacggaggacattggcc
caatctagaaggctttctgaaagagccctctccttggaggaaaatggggttggatccaac
ttcaaaacctccaccctgagcgttagcagctttttcaagcaggaaggagatcgccttagt
gatgaagacttattcaagtttttagctgactacaaaagatcatcatccttacagagacga
gtcaagtcaattccaggcttgctgagattggagatttctacagctccagagatcatcaat
ggctgtctgactcctgaaatgctgcccatgaaaccctttcctgaaaaccggacgcgcccg
cacaaggagattttggaatttccaacacgagaagtgtacgtccctcacactgtgtacaga
aaccttctctatgtctacccacagaggctgaactttgttaacaagctagcatcggcccgg
aacattacaataaagatccagtttatgtgtggagaagatgctagcaacgcgatgccggtc
atctttggaaagtccaacgggcctgaatttctgcaggaagtgtacacagctgttacatac
cataataagtctcctgacttttatgaagaagtgaaaattaagctccccgctaagctcaca
gtaaatcaccacctcctgttcaccttctaccatatcagctgtcagcagaagcaaggagcc
tccgtggaaactctcctgggatattcatggctgccaattctcttaaatgaacgtcttcaa
actggatcctactgtctcccagttgccttggaaaaattgccacccaactactccatgcat
tctgctgagaaagtcccattacagaatcctcccattaagtgggctgaaggacataaggga
gtatttaatattgaagtgcaagctgtttcttctgtgcacacccaggacaaccacctggag
aagttcttcaccctctgccactccctggagagccaggtgaccttccccatccgcgtgctg
gatcagaaaatcagtgagacggcactggagcatgagctgaagctcagcatcatctgcctg
aactcctcccgcctggagccgctcgtgctcttcctgcacctggtgctggacaagctcttc
cagctgtccgtgcagcccatggtcatcgctggccagacagccaacttctcccagtttgcc
ttcgagtccgtggtggccatcgccaacagtctgcacaacagcaaggacctgagcaaggac
cagcacgggaggaactgcctgctggcttcctacgtgcactacgtcttccgcctgccagag
gtgcaaagggacgtgcccaagtcaggcgctcccactgccatccccgaccctcggagctac
cacacgtatggacgcacgtcagctgctgctgtgagttcaaagctgctgcaggcccgggtg
atgagcagcagtaacccagacctcgcagggacacactccgcagcagacgaggaagtgaag
aacatcatgtcttcaaagatcgccgagcgcaactgcagccggatgtcttactattgctct
ggcaatagtgatgttccaggttcaactgcagccccaaggccagccagcaaaaagcatttc
catgaggagcttgccctccagatggtggtcagcaccggaatggtgagagaaacagtcttc
aagtatgcctggttcttctttgagcttctggtgaaaagcatggcccagcatgtacataac
atggacaaacgggacagttttcggaggactcgtttttctgaccgtttcatggatgacgta
actactattgttaatgtggtcacctcggaaattgcagcccttttagtaaaagcacagaag
gaaaacgaacaggcggaaaagatgaacatcagcctggctttcttcttgtacgaccttctc
tccctcatggatcggggctttgtgtttaacctcatcagacattattgcaaccagctgtca
gccaagctcaataaccttccaacgctcatttccatgaggctggagttcctgagaatcctc
tgtagccatgaacattacctcaatctgaaccttttttttatgaatgctgatgccgctcca
acatctccttgtccttccatatcttctcagaactcgagctcctgctccagtttccaggac
cagaagatcgccagcatgttcgatctgacttccgagtaccgccagcagcacttcctcacc
gggctcctcttcacagaactggctgctgctctggatgccgaagcggaaggaatcagcaaa
gtacaaaggaaagctgtcagtgccatccacagcctgctaagttctcacgacctggaccca
cgctgtgtcaaaccagaggtgaaggtcaaaatcgctgccttttacctgcctttagttggc
atcattctggatgctttgccacagctctgtgactttacagttgcagatactcgcagatac
cgcaccagcggctcggatgaagaacaagaaggagctggtgccattaaccagaatgtggct
ctggccatagcagggaataatttcaatttgaaaacaagtggaatagtgctgtcttccttg
ccctataagcaatacaacatgctgaacgccgacactactcgcaacctcatgatctgcttc
ctctggatcatgaaaaatgctgatcagagcctcattaggaagtggattgctgacctgcca
tcaatgcagctcaacaggattttagatctgcttttcatctgtgtcttatgttttgagtat
aagggaaaacagagttctgacaaagtcagtacccaagccctgcagaagtcaagggatgtc
aaggcccggctggaagaggctttgctccgtggggaaggggccagaggggagatgatgcgc
cgtcgggctccagggaacgaccgatttccaggcctaaatgaaaatttgagatggaagaaa
gagcagacacattggcggcaagctaatgagaagctagataaaacaaaggcagagttagat
caagaagccttgatcagtggcaatctggctacagaagcacatttaatcatcctggatatg
caggaaaacattatccaggcgagctcggctctggactgtaaagacagcctgctgggaggt
gttctgagggtgctggtgaattctctgaactgtgatcagagtaccacctacctgactcac
tgctttgcaacactccgtgctctcattgccaagtttggagacttactcttcgaagaggag
gtggagcagtgtttcgacctgtgtcaccaagtcctgcaccactgcagcagcagcatggat
gtcacccggagccaagcctgtgccaccctttacctcctcatgaggttcagttttggagcc
accagtaactttgcaagagtaaagatgcaagtaaccatgtcgctggcatctttggtggga
agagcaccagactttaatgaagagcacctgagaagatccttgaggacaattttggcctat
tcagaagaggacacagccatgcagatgactccttttcccacccaggtggaggaacttctt
tgtaatctgaatagcatcttatatgacacggtgaaaatgagggaatttcaggaagatcct
gagatgcttatggatctcatgtacagaattgccaagagttaccaggcatctcctgatctg
cggctgacctggctccagaacatggcagagaaacacaccaagaagaagtgctacacggag
gctgccatgtgcctggtgcacgccgctgcgttagtggctgagtatctgagcatgctggag
gaccacagctacctgcccgtgggcagtgtcagcttccagaatatttcttccaatgtgctg
gaggagtctgtggtctctgacgacaccctgtcacctgacgaggatggggtgtgcgcaggc
cagtacttcaccgagagtggcctggtgggcctcctggagcaggctgcggagctcttcagc
acgggaggcttatatgagacggttaatgaggtctacaagctggtcatccccatcctagaa
gcgcatcgagaattccggaagctgacactcacccacagcaagctgcagagggccttcgac
agcatcgttaacaaggatcataagagaatgtttggaacctacttccgagttggtttcttt
ggatccaaatttggggatttggatgaacaggaatttgtttacaaagagcctgcaattacc
aagcttcctgagatctcacatagactagaggcattttatggtcagtgttttggtgcagaa
tttgtggaagtgattaaagactccactcctgtggacaaaaccaagttggatcctaacaag
gcctacatacagatcacttttgtggagccctactttgatgagtatgagatgaaagacagg
atcacatactttgagaagaatttcgacctccggaggttcatgtacaccaccccgttcacc
ctggaggggcggcctcggggagagctgcatgagcagtacagaaggaacacagtcctgacc
actatgcacgccttcccctacatcaagaccaggatcagcgtcatccagaaggaggagttt
gttttgacaccaattgaagttgccattgaagacatgaagaagaagaccctgcagttagcg
gttgccattaaccaagagccgcctgatccaaagatgcttcagatggtgcttcaaggctct
gtgggagctactgtaaatcagggaccactggaagtagcccaagtgttcttggctgaaatt
cctgctgatccaaaactctatcgatatcacaacaagttgaggttatgctttaaggaattc
atcatgagatgtggtgaagccgtggagaaaaacaagcgtctcatcacggcagaccagagg
gaatatcagcaggaactcagaaagaactataacaagctaaaagagaacctcaggccaatg
atcgagcggaaaattccagaactgtacaagccaatattcagagttgagagtcaaaagagg
gactccttccacaggtctagtttcaggaaatgtgaaacccagttgtcacagggcagctaa

DBGET integrated database retrieval system