KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100600191Help
Entry
100600191         CDS       T03265                                 

Gene name
A1CF
Definition
(RefSeq) APOBEC1 complementation factor
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 DND1_DSRM RRM_5 RRM_7 Limkain-b1 BRAP2 ERp29 HEPN_AbiU2
Motif
Other DBs
NCBI-GeneID: 100600191
NCBI-ProteinID: XP_003255205
Position
3
AA seq 587 aa AA seqDB search
MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFI
GKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKLEAKNAIKQLNNYE
IRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRG
FAFVEYESHRAAAMARRKLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLML
STSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTL
AKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAPQAYAAIPSLH
FPATKGHLSNRAIIRAPSVRGAAGVRGLGGRGYLAYTGLGRGYQVKGDKREDKLYDILPG
MELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPAL
ASQNPAIHPFTPPKLSAYVDEAKTYAAEYTLQTLGIPTDGGDAGTMATAAAAATAFPGYA
VPNATAPVSAAQLKQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGAF
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaaatcacaaatccggggatggattgagcggcactcagaaggaagcagccctc
cgcgcactggtccagcgcacaggatatagcttggtccaggaaaatggacaaagaaaatat
ggtggccctccacctggctgggatgctgcaccccctgaaaggggctgtgaaatttttatt
ggaaaacttccccgagacctttttgaggatgagcttataccattatgtgaaaaaatcggt
aaaatttatgaaatgagaatgatgatggattttaatggcaacaatagaggatatgcattt
gtaacattttcaaataaactggaagccaagaatgcaatcaagcaacttaataattatgaa
attagaaatgggcgcctcttaggggtttgtgccagcgtggacaactgccgattatttgtt
gggggcatcccaaaaaccaaaaagagagaagaaatcttatcggagatgaaaaaggttact
gaaggtgttgtcgatgtcatcgtctacccaagcgctgcagataaaaccaaaaaccgaggc
tttgcctttgtggagtatgagagtcatcgagcggctgccatggcgaggagaaaactgcta
ccaggacgaattcagttatggggacatcctattgcagtagactgggcagagccagaagta
gaagttgatgaagatacaatgtcttcagtgaaaatcctatatgtaagaaatcttatgctg
tctacctctgaagagatgattgaaaaggaattcaacaatatcaaaccaggtgctgtggag
agggtgaagaaaattcgagactatgcttttgtgcacttcagtaaccgagaagatgcagtt
gaggctatgaaagctttaaatggcaaggtgctggatggttcccccattgaagtcacccta
gcaaaaccagtggacaaggacagttacgttaggtatacccgaggcacaggtggaaggggc
accatgctgcaaggagagtatacctactctttgggccaagtttatgaccccaccacaacc
taccttggagctcccgtcttctatgccccccaggcctatgcagcaattcccagtcttcat
ttcccagccaccaaaggacacctcagcaacagagccattatccgagccccttctgttaga
ggggctgcgggagtgagaggactgggcggccgtggctatttggcatacacaggcctgggt
cgaggataccaggtcaaaggagacaaaagagaagacaaactgtatgacattttacctggg
atggagctcaccccaatgaatcctgtcacgttaaaaccccaaggaattaaactcgctccc
cagatattagaagagatttgtcagaaaaataactggggacagccagtgtaccagctgcac
tctgctattggacaagaccaaagacaactattcttgtacaaaataaccattcctgctcta
gccagccagaatcctgcaattcaccctttcacacctccaaagctgagtgcctatgtggat
gaagcaaagacgtatgcagctgaatacaccctgcagaccctgggcatccccactgatgga
ggcgatgctggcaccatggctactgctgctgctgctgctaccgctttcccaggatatgct
gtccctaatgcaactgcacctgtgtctgcagcccagctcaagcaagcggtaacccttgga
caagacttagcagcatatacaacctatgaggtctacccaacttttgcagtgactgcccga
ggggatggatatggcgccttctga

DBGET integrated database retrieval system