KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100600466Help
Entry
100600466         CDS       T03265                                 

Gene name
VPS4A
Definition
(RefSeq) vacuolar protein sorting 4 homolog A
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04144  Endocytosis
nle04217  Necroptosis
Module
nle_M00412  ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:nle00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100600466 (VPS4A)
  09143 Cell growth and death
   04217 Necroptosis
    100600466 (VPS4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100600466 (VPS4A)
Membrane trafficking [BR:nle04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100600466 (VPS4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 TIP49 IstB_IS21 AAA_22 AAA_16 RuvB_N AAA_14 AAA_5 DUF815 AAA_18 AAA_2 AAA_33 RNA_helicase AAA_17 AAA_24 PhoH AAA_7 NACHT Mg_chelatase Sigma54_activat YCII YhdB Sigma54_activ_2 AAA_30 MCM
Motif
Other DBs
NCBI-GeneID: 100600466
NCBI-ProteinID: XP_003262987
UniProt: A0A2I3HIG6
Position
2
AA seq 437 aa AA seqDB search
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKC
VQYLDRAEKLKDYLRSKEKHGKKPVKESQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVME
KPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAV
ATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENE
SEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARA
QMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCG
PSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA
DDLLKVKKFSEDFGQES
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgtcaaccctccagaaagccattgatctggtgacgaaagccacagaagaggac
aaagccaagaactacgaggaggcactgcggctgtaccagcatgcggtggagtacttcctc
catgccatcaagtatgaggcccacagcgacaaggccaaggagagcattcgagccaaatgc
gtgcagtacctagaccgggctgagaagctgaaggattatttacgaagcaaagagaaacac
ggcaagaagccagtcaaagagagccagagtgagggcaagggcagtgacagtgacagtgaa
ggggataatccggagaaaaagaaactgcaagaacagctgatgggtgccgttgtgatggag
aagcccaacatacggtggaacgacgtggccgggctggagggggccaaggaggccctcaaa
gaagctgtcattttgccaatcaaattcccacacttgttcacaggcaagcgcaccccctgg
cgggggattctgctgttcggaccccctggcacagggaaatcctacctggccaaagctgtg
gcaacagaggccaacaactccaccttcttctccgtgtcctcctcagatctgatgtccaag
tggctgggggagagtgaaaagctggtcaagaacctgtttgagctggccaggcagcacaag
ccctccatcatcttcatcgacgaggtggattccctctgcgggtcccgaaatgaaaatgag
agtgaggctgcccggaggatcaaaacggagttcttggtccagatgcagggggtggggaat
aacaatgatgggactctggttcttggagccacaaacatcccatgggtgttggattcggcc
atcaggaggaggtttgaaaagcgcatttatatccccctgccggaggaagctgcccgcgcc
cagatgttccggttgcatctcgggagcactccccacaacctcacggatgcaaacatccac
gagctggcccggaagacggaaggctactcgggcgcggacatcagcatcatcgtgcgggac
tccctcatgcagcccgtgaggaaggtgcagtcggccacacacttcaaaaaggtctgcggc
ccctctcgcaccaaccccagcatgatgattgatgacctcctgactccatgctcaccaggg
gacccaggagccatggagatgacttggatggatgtccctggggacaaactcttagagcct
gtggtttgcatgtcagacatgctgcggtctctggccaccacccggcccacggtgaatgca
gacgacctcctgaaagtgaagaaattctcagaggactttgggcaagagagttaa

DBGET integrated database retrieval system