KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100601437Help
Entry
100601437         CDS       T03265                                 

Definition
(RefSeq) cytochrome P450 2C19 isoform X1
  KO
K17721  cytochrome P450 family 2 subfamily C polypeptide 19 [EC:1.14.14.51 1.14.14.52 1.14.14.53 1.14.14.75 1.14.14.-]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00590  Arachidonic acid metabolism
nle00591  Linoleic acid metabolism
nle00982  Drug metabolism - cytochrome P450
nle01100  Metabolic pathways
nle04726  Serotonergic synapse
nle05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100601437
   00591 Linoleic acid metabolism
    100601437
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100601437
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100601437
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100601437
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nle00199]
    100601437
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.51  (S)-limonene 6-monooxygenase
     100601437
    1.14.14.52  (S)-limonene 7-monooxygenase
     100601437
    1.14.14.53  (R)-limonene 6-monooxygenase
     100601437
    1.14.14.75  fenbendazole monooxygenase (4'-hydroxylating)
     100601437
    1.14.14.-  
     100601437
Cytochrome P450 [BR:nle00199]
 Cytochrome P450, animal type
  CYP2 family
   100601437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100601437
NCBI-ProteinID: XP_003255293
Ensembl: ENSNLEG00000013002
UniProt: G1RRD4
Position
3
AA seq 490 aa AA seqDB search
MDPFVVLVLCLSCLLLLSLCRQRSGRGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKV
YGPVFTLYFGLERMVVLHGYEAVKEALIDLGEEFSGRGHFPLAERTNRGFGIVFSNGKRW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFQKRFDYKDQQFLNLMEKLNENVRIVSTPWIQICNNFPPIIDYFPGTHNKLLKNIAFM
ESYILEKVKEHQESIDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTE
TTSTTLRYALLLLLKHPEVTAKAQEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYID
LIPTNLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDGGGNFK
KSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVP
PFYQLCFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccttttgtggtccttgtgctctgtctctcatgtttgcttctcctttcactatgc
agacagaggtctgggagaggaaaactccctcctggccccactcctctcccagtgattgga
aatatcctacagatagatattaaggacgtcagcaaatccttaaccaatctctcaaaagtc
tatggccctgtgttcactctgtattttggcctggaacgcatggtggtgctgcatggatat
gaagcggtgaaggaagccctgattgatcttggagaggaattttctggaagaggccatttc
ccactggctgaaagaactaacagaggatttggaatcgttttcagcaatggaaagagatgg
aaggagatccggcgtttctccctcatgacgctgcggaattttgggatggggaagaggagc
attgaagaccgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaag
gcctcaccctgtgaccccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
attattttccagaaacgttttgattataaagatcagcaatttcttaacttgatggaaaaa
ttgaatgaaaatgtcaggattgtgagcaccccctggatccagatatgcaataattttccc
cctatcattgattatttcccgggaacccacaacaaattacttaaaaacattgcttttatg
gaaagttatattttggagaaagtaaaagaacaccaagaatcgatagacataaacaaccct
cgggactttattgattgcttcctgatcaaaatggagaaggaaaagcaaaaccaacagtct
gaattcactattgaaaacttggtaatcactgcagctgacttacttggagctgggacagag
acgacaagcacaaccctgagatatgctctccttctcctgctaaagcacccagaggtcaca
gctaaagcccaggaagagattgaacgagtcattggcagaaaccggagcccctgcatgcag
gacaggggccacatgccctacacagatgctgtggtgcacgaagtccagagatacattgac
ctcatccccaccaacctgccccatgcagtgacctgtgacgttaaattcagaaactacctc
attcccaagggcacaaccatattaacttccctcacttctgtgctacatgacaacaaagaa
tttcccaacccagagatgtttgaccctcgtcactttctggatggaggtggcaattttaag
aaaagtaactacttcatgcctttctcagcaggaaaacggatttgtgtgggagagggcctg
gcccgcatggagctgtttttattcctgaccttcattttacagaattttaacctgaaatct
ctgattgacccaaaggaccttgacacaactcctgttgtcaatggatttgcttctgtccca
cccttctatcagctgtgcttcattcctgtctga

DBGET integrated database retrieval system