KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100602026
Entry
100602026         CDS       T03265                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nle01002]
    100602026 (ERAP1)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100602026 (ERAP1)
Peptidases and inhibitors [BR:nle01002]
 Metallo peptidases
  Family M1
   100602026 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570
Other DBs
NCBI-GeneID: 100602026
NCBI-ProteinID: XP_003277241
Ensembl: ENSNLEG00000014076
UniProt: G1RV93
Position
2
AA seq 942 aa
MVFLSLKWSLATMSFLLVGSLLAVLTVCTPSWCQSSEASPKGSDGTPFPWNKIRLPEYVI
PVHYDLLIHANLTTLTFWGTTEVEITANQPTSTIILHSHHLQISRAILRKGAGERLSEEP
LQVLEHPAQEQIALLAPEPLLVGLPYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAS
TQFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVT
VKMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVAHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYFFGKCFDAMEVDALNSSHPV
STPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNDDLW
DSMASICPTDGVKGMDGFCSRSQHSSSSSHWHQEGLDVKTMMNTWTLQKGFPLITITVRG
RNVHMKQEHYMKGSDGAPGTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALD
LSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDG
GSVSERMLRSELLLLACVRKYQPCVQRAEGYFRKWKESNGTLSLPVDVTLAVFAVGAQST
EGWDFLYSKYQFSLSSTEKNQIEFALCTTQNKEKLQWLLDESFKGDKIKTQEFPKILILI
GRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIRAWLQSEKLELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggtgtttctgtccctcaaatggtcccttgcaaccatgtcatttctacttgttggctca
ctgttggctgtcttaactgtgtgcactccttcatggtgtcagagcagtgaagcatctcca
aaaggtagtgatgggacgccatttccttggaataaaatacgacttcctgagtacgtcatc
ccagttcattatgatctcttgatccatgcaaaccttaccacgctgaccttctggggaacc
acggaagtagaaatcacagccaatcagcccaccagcaccatcatcctgcatagtcaccac
ctgcagatatctagggccatcctcaggaagggagctggagagaggctatccgaagaaccc
ctgcaggtcctggaacaccccgctcaggagcaaatcgcgctgctggctcccgagcccctc
cttgtcgggctcccgtacacagttgtcattcactatgctggcaatctttcggagactttc
cacggattttacaaaagcacctacagaaccaaggaaggggaactgaggatacttgcatca
acacaatttgaacccactgcagctagaatggcctttccctgctttgatgaacctgccttc
aaagcaagtttctcaatcaaaattagaagagagccaaggcacctggccatctccaatatg
ccattggtgaaatctgtgactgttgctgaaggactcatagaagaccattttgatgtcact
gtgaagatgagcacctatctggtggccttcattatttcagattttgagtctgtcagcaag
ataaccaagagtggagtcaaggtttctgtttatgctgtgccagacaagataaatcaagca
gattatgcactggatgctgcggtgactcttctagaattttatgaggattatttcagcata
ccgtatcccctacccaaacaagatcttgctgctattcccgactttcagtctggtgctatg
gaaaactggggactgacaacatatagagaatctgctctgttgtttgatgcagaaaagtct
tctgcatcaagtaagcttggcatcacaatgactgtggcccatgaactggcccaccagtgg
tttgggaacctggtcactatggaatggtggaatgatctttggctaaatgaaggatttgcc
aaatttatggagtttgtgtctgtcagtgtgacccatcctgaactgaaagttggagattat
ttctttggcaaatgttttgacgcaatggaggtagatgctttaaattcctcacatcctgtg
tctacacctgtggagaatcctgctcagatccgggagatgtttgatgatgtttcttatgat
aagggagcttgtattctgaatatgctaagggagtatcttagtgctgatgcatttaaaagt
ggtattgtacagtatctccagaagcatagctataaaaatacaaaaaacgacgacctgtgg
gatagtatggcaagtatttgccctacagatggtgtaaaagggatggatggcttttgctct
agaagtcaacattcatcttcatcctcacactggcatcaggaagggctggatgtgaaaacc
atgatgaacacttggacactgcagaagggttttcccctgataaccatcacagtgaggggg
aggaacgtacacatgaagcaagagcactacatgaagggctctgacggcgccccgggcact
gggtacctgtggcatgttccattgacattcatcaccagcaaatcagacatggtccatcga
tttttgctaaaaacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgtgggcatgaatggctattacattgtgcattacgaggatgatggatgggactct
ttgactggccttttaaaaggaacacacacagcagtcagcagtaatgatcgggcgagtctc
attaacaatgcatttcaactcgtcagcattgggaagctgtccattgaaaaggccttggat
ttatccctgtacttgaaacatgaaactgaaattatgcccgtgtttcaaggtttgaatgag
ctgattcctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcaattc
aaggccttcctcatcaggctgctaagggacctcattgataagcagacgtggacagacggg
ggctcagtctcagagcgaatgctgcggagtgagctactcctccttgcctgtgtgcgcaag
tatcagccgtgcgtacagagggcagaaggctatttcagaaagtggaaggaatccaatgga
accttgagcctgcctgtcgacgtgaccttggcagtgtttgctgtgggggcccagagcaca
gaaggctgggattttctttatagtaaatatcagttttctttgtccagtactgagaaaaac
caaattgaatttgccctctgcacaacccaaaataaggaaaagcttcaatggctactagat
gaaagctttaagggagataaaataaaaactcaggagtttccaaaaattcttatactcatt
ggcaggaacccagtaggatacccattggcctggcaatttctgaggaaaaactggaacaaa
cttgtacaaaagtttgaacttggctcatcttccatagcccacatggtaatgggtacaaca
aatcaattctccacaagaacacggcttgaagaggtaaaaggattcttcagctctttgaaa
gaaaatggttctcagctccgttgtgtccaacagacaattgaaaccattgaagaaaacatc
cgttggatggataagaattttgataaaatcagagcgtggctgcaaagtgaaaagcttgaa
cttctgtaa

DBGET integrated database retrieval system