KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100602088Help
Entry
100602088         CDS       T03265                                 

Gene name
LCT
Definition
(RefSeq) lactase-phlorizin hydrolase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00052  Galactose metabolism
nle01100  Metabolic pathways
nle04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100602088 (LCT)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100602088 (LCT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nle03110]
    100602088 (LCT)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     100602088 (LCT)
    3.2.1.108  lactase
     100602088 (LCT)
Chaperones and folding catalysts [BR:nle03110]
 Intramolecular chaperones
  Others
   100602088 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 100602088
NCBI-ProteinID: XP_003267652
Ensembl: ENSNLEG00000008718
UniProt: G1RBR5
Position
20
AA seq 1927 aa AA seqDB search
MELSWHVVFIALLSFSCWGSDWESDRNFISTAGPLTNDLLHNLSGLLGDQSSNFVAGDKD
MYVCHQPLPAFLPEYFSSLHASQITHYKVFLSWAQLLPAGSTQNPDEKTVQCYRRLLEAL
KTARLQPMVILHHQTLPASTLQRTEAFADLFANYATFAFHSFGDLVGIWFTFSDLEEVIK
ELPHQESRASQLQTLSDAHRKAYEVYHENYASQGGKLSVVLRAEDIPELLLEPPISALGQ
DAVDFLSLDLSYECQNEASLRQKLSKLQTIEPKVKVFIFNLKLPDCPSTMKNPARLLFSL
FEAINKDQVLTIGFDINEFLSCSSSSKKSMSCSLTDSLALQPDQQQDHETTGSSPASAYQ
RVWEAFANQSRVERDAFLQDTFPEGFLWGASTGAFNVEGGWAEGGRGASIWDPHRPLNTT
EGQATPEVASDSYHKVASDVALLRGLRAQVYKFSISWSRIFPTGHGSSPSLPGVAYYNKL
IDRLRDAGIEPMATLFHWDLPQALQDHGGWQNESVVDAFLDYAAFCFSTFGDRVKLWVTF
HEPWVMSYAGYGTGQHPPSISDPGVASFKVAHLVLKAHARTWHHYNSHHRPQQQGHVGIV
LNSDWAEPLSPERPEDLRASERFLHFMLGWFAHPIFVDGDYPATLRTQIQQMNRQCSHPV
AQLPEFTEAEKQLLKGSADFLGLSHYTSRLISNAPQNTCIPSYDNIGGFSQHVNHVWPQT
SSSWIRVVPWGIRRLLQFVSLEYTRGKVPIYLAGNGMPIGESENLFDDSLRVDYFNQYIN
EVLKAIKEDSVDVRSYIARSLIDGFEGPSGYSQRFGLHHVNFSDSSKSRTPRKSAYFFTS
IIEKNGFLTKGAKRLLPPNTANLPSKVRAFTFPSEVPSKAKVVWEKFSSQPKFERDLFYH
GTFRDDFLWGVSSSAYQIEGGWDADGKGPSIWDNFTHTPGSNVKDNATGDIACDSYHQLD
ADLNMLRALKVKAYRFSISWSRIFPTGRNSSINSQGVDYYNRLINGLVASNIFPMVTLFH
WDLPQALQDIGGWENPALIDLFDSYADFCFHTFGDRVKFWMTFNEPMYLAWLGYGSGEFP
PGVKDPGWAPYRIAHTIIKAHARVYHTYDEKYRQEQKGVISLSLSTHWAEPKSPGVPRDV
EAADRMLQFSLGWFAHPIFRNGDYPDTMKWKVGNRSELQHLATSRLPSFTEEEKRFIRAT
ADVFCLNTYYSKIVQHKTPSLNPPSYEDDREMAEEEDPSWPSTAMNRAAPWGTRRLLNWI
KEEYGDIPIYITENGVGLTNPNTEDTDRIFYHKTYINEALKAYRLDGVDLRGYVAWSLMD
NFEWLNGYTVKFGLYHVDFNNTNRPRTARTSARYYTEVITNNGMPLAREDEFLYGRFPEG
FIWSAASAAYQIEGAWRADGKGLSIWDTFSHTPLKVEDDAIGDVACDSYHKIAEDLVTLQ
NLGVSHYRFSISWSRILPDGTTRYINEAGLNYYVRLIDALLAASIQPQVTIYHWDLPQAL
QDVGGWENETIVQWFKEYADVLFQRLGDKVKFWITLNEPFVIAYQGYGYGTKAPGISNRP
GTAPYIVGHNLIKAHAEAWHLYNDVYRASQGGVISITISSDWAEPRDPSNQEDVEAARRY
VQFMGGWFAHPIFKNGDYNEVMKTRIRDRSLAAGLNKSRLPEFTESEKRRINGTYDFFGF
NHYTTVLAYNLNYATAISSFDADRGVASIADRSWPDSGSLWLKMTPFGFRRILNWLKEEY
NDPPIYVTENGVSQREETDLNDTVRIYYLRTYINEALKAVQDKVDLRGYTVWSAMDNFEW
ATGFSERFGLNFVNYSDPSLPRIPKASAKFYASVVRCNGFPDPATGPHACLHQPDAGPTI
SPVRQEEVQFLGLMLGTAEAQTALYVLFSLVLLGVCGLAFLSYKYCKRSKQGKTQRSQQE
LSPVSSF
NT seq 5784 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtcttggcatgtagtctttattgccctgctaagtttttcatgctgggggtca
gactgggagtctgatagaaatttcatttccaccgctggtcctctaaccaatgatttgctg
cacaacctgagtggtctcctgggagaccagagttctaactttgtagcaggggacaaagac
atgtatgtttgtcaccagccactgcccgctttcctgccagaatacttcagcagtctccat
gccagtcagatcacccactataaggtatttctatcatgggcacagctcctcccagcagga
agcacccagaatccagacgagaaaacagtgcagtgctaccggcgactcctggaggccctc
aagactgcacggcttcagcccatggtcatcctgcaccaccagaccctccctgccagcacc
ctccagagaactgaagccttcgctgacctcttcgccaactatgccacattcgccttccac
tccttcggggacctagttgggatctggttcaccttcagtgacttggaggaagtgatcaag
gagcttccccaccaggaatcaagagcgtcacaactccagaccctcagtgatgcccacaga
aaagcctatgaggtttaccacgaaaactatgcttctcagggtgggaaactctctgttgtc
ctgcgagctgaagatatcccggagctcctgctagaaccacccatatctgcgcttggtcag
gatgcggtcgatttcctctctcttgatttgtcttatgaatgccaaaatgaggcaagtctg
cggcagaagctgagtaaattgcagaccattgagccaaaagtgaaagttttcatcttcaac
ctaaaactcccggactgcccctccaccatgaagaacccagccaggctgcttttcagcctt
tttgaagccataaataaagaccaagtgctcaccattgggtttgatattaatgagtttctg
agttgttcatcaagttccaagaaaagcatgtcttgttctctgactgacagcctggccctt
cagcctgaccagcagcaggaccacgagaccacaggctcctctcctgcctctgcctatcag
agagtctgggaagcatttgccaatcagtccagggtggaaagggatgccttcctgcaggac
actttccccgaaggcttcctctggggtgcctccacaggagcctttaacgtggaaggaggc
tgggccgagggcgggagaggggcgagcatctgggatccacacaggcccctgaacaccact
gagggccaagcgacgccggaggtggccagtgacagctaccacaaggtagcctctgatgtc
gccctgcttcgcggcctccgggctcaggtgtacaagttctccatctcctggtcccggatc
ttccccacggggcacgggagcagccccagcctcccaggcgttgcctactacaacaagctg
attgacaggctgcgggatgcgggcatcgagcccatggccacactgttccactgggacctg
cctcaggccctgcaggatcatggcggatggcagaatgagagtgtggtggatgccttcctg
gactatgcggccttctgcttctccacgtttggggaccgtgtgaagctgtgggtgaccttc
catgagccgtgggtgatgagctacgcgggctatggcactggccagcaccctcccagcatc
tctgacccaggagtggcctcttttaaggtggctcacttggtcctcaaggctcatgccaga
acttggcaccactacaacagccaccatcgcccacagcagcaggggcacgtgggcattgtg
ctgaactcagactgggcagaacccctgtctccagagaggcctgaggacctgagagcctct
gagcgcttcttgcacttcatgctgggctggtttgcacaccccatctttgtggatggagac
tacccagccaccctgaggacccagatccaacagatgaacagacagtgctcccatcctgtg
gctcaactccccgagttcacggaggcagagaagcagctcctgaaaggctctgctgatttt
ctgggtctgtcgcattacacctcccgcctcatcagcaacgccccacaaaacacctgcatc
cctagctatgataacattggaggcttctcccaacacgtgaaccatgtgtggccccagacc
tcatcctcttggattcgtgtggtgccctgggggataaggaggctgttgcagtttgtatcc
ctggaatacacaagaggaaaagttccaatatacctggccgggaatggcatgcccataggg
gaaagtgaaaatctctttgatgattccttgagagtagactacttcaatcaatatatcaat
gaggtgctcaaggctatcaaggaagactccgtggatgttcggtcctacattgctcgttcc
ctcattgatggcttcgaaggcccttctggttacagccagcggtttggcctgcaccacgtc
aacttcagcgacagcagcaagtcaaggactcccaggaaatctgcctactttttcactagc
atcatagaaaagaacggtttcctcaccaagggggcaaaaagactgctaccacctaataca
gcaaacctcccctccaaagtcagagccttcacttttccatctgaagtgccctccaaggct
aaagttgtttgggaaaagttctccagccaacccaagttcgaaagagatttgttctaccac
gggacgtttcgggatgactttctgtggggcgtgtcctcttccgcttatcagatcgaaggc
gggtgggatgccgatggcaaaggccccagcatctgggataactttactcacacaccaggg
agcaatgtgaaagacaatgccactggagatatcgcctgcgatagctatcaccagctggat
gccgatctgaatatgctccgcgctttgaaggtgaaggcctaccgcttctccatctcctgg
tctcggattttcccaactgggagaaacagctctatcaacagtcaaggggttgattattac
aataggctgatcaatggcttggtggcaagcaacatctttcccatggtgacattgttccac
tgggacctgccccaggccctccaggatattggaggctgggagaatcctgccttgattgac
ttgtttgacagctacgcagacttttgtttccatacctttggtgacagagtcaagttctgg
atgacttttaatgagcccatgtacctggcatggctgggttatggctcaggggaatttccc
ccaggggtgaaggacccaggctgggcaccatataggatagcccacaccatcatcaaagcc
catgccagagtctatcacacgtacgatgagaaatacaggcaggagcagaagggggtcatc
tcgctgagcctcagtacacactgggcagagcccaagtcaccaggggtccccagagatgtg
gaagccgctgaccgaatgctgcagttctccctgggctggtttgctcaccccatttttaga
aacggagactatcctgacaccatgaagtggaaagtggggaacaggagtgaactgcagcac
ttagccacctcccgcctgccaagcttcactgaggaagagaagaggttcatcagggcaacg
gccgacgtcttctgcctcaacacgtactactccaaaatcgtgcagcacaaaacacctagt
ctaaacccaccctcctacgaagacgaccgggagatggctgaggaggaggacccttcgtgg
ccttccacggcaatgaacagagctgcgccctgggggacgcgaaggctgctgaactggatc
aaggaagagtatggtgacatccccatttacatcaccgaaaacggagtggggctgaccaat
ccaaacacagaggatactgataggatattttaccacaaaacctacatcaatgaggctttg
aaagcctacaggctcgatggtgtagaccttcgagggtatgtcgcctggtctctgatggac
aactttgagtggctgaatggctacacggtcaagtttggactataccatgttgatttcaac
aacacgaacaggcctcgcacagcaagaacctccgccaggtactacacagaggtcattacc
aacaacggcatgccactggccagggaggatgagtttctgtacggacggtttcctgagggc
ttcatctggagtgcagcttctgctgcatatcagatcgaaggtgcgtggagagcagatggc
aaaggactcagcatttgggacacgttttctcacacaccactgaaggttgaggatgatgcc
atcggagacgtggcctgcgacagttatcacaagattgctgaggatctggtcaccctgcag
aacctgggcgtgtcccactaccgtttttccatctcctggtctcgcatcctccctgatgga
accaccaggtacatcaatgaagcgggcctgaactactacgtgagactcatcgatgcactg
ctggccgctagcatccagccccaggtgaccatttaccactgggacctaccgcaggcgctc
caagatgtaggaggctgggagaatgagaccatcgtgcagtggtttaaggagtatgcagat
gtgctcttccagaggctgggagacaaggtgaagttttggatcacactgaatgagcccttt
gtcattgcttaccagggctatggctacggaacaaaagctccaggaatctccaataggccc
ggcactgccccctacattgttggccacaacctaataaaggctcatgctgaggcctggcat
ctgtacaacgatgtgtaccgcgccagtcaaggtggcgtgatttccatcaccatcagcagt
gactgggctgaacccagagatccctctaaccaggaggatgtggaggcagccaggagatat
gttcagttcatgggaggctggtttgcacatcctattttcaagaatggagattacaatgag
gtgatgaagacgcggatccgtgacaggagcttggctgcaggcctcaacaagtctcggctg
ccagaatttacagagagtgagaagaggaggatcaacggcacctatgacttttttgggttc
aatcactataccactgtcctcgcctacaacctcaactatgccactgccatctcttctttt
gatgcagacagaggagttgcttccatcgcagatcgctcgtggccagactctggctccctc
tggctgaagatgacgccttttggcttcaggaggatcctgaactggttaaaggaggaatac
aatgaccctccaatttatgtcacagagaatggagtgtcccagcgggaagaaacagacctc
aatgacactgtaaggatctactaccttcggacttacatcaatgaggccctcaaagctgtg
caggacaaggtggacctgcgaggatacacagtttggagtgcgatggacaattttgagtgg
gccacaggcttttcagagagatttggtctgaattttgtgaactacagtgacccttctctg
ccaaggatccccaaagcatcagcgaagttctatgcctctgtggtccgatgcaatggcttc
cctgaccccgctacagggcctcacgcttgtctccaccagccagatgctggacccaccatc
agccctgtgagacaggaggaggtgcagttcctggggctaatgctcggcaccgcagaagca
cagacagctttgtacgttctcttttctcttgtgctgcttggagtctgtggcttggcattt
ctgtcatacaagtactgcaagcgctctaagcaagggaaaacacaacgaagccaacaggaa
ttgagcccggtgtcttcattctga

DBGET integrated database retrieval system