KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100602225Help
Entry
100602225         CDS       T03265                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00010  Glycolysis / Gluconeogenesis
nle00562  Inositol phosphate metabolism
nle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100602225 (MINPP1)
   00562 Inositol phosphate metabolism
    100602225 (MINPP1)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100602225 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100602225 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 100602225
NCBI-ProteinID: XP_003255213
UniProt: A0A2I3G8H7
Position
3
AA seq 487 aa AA seqDB search
MLRAPRCLFRTSVAPAAALAAALLSSLARCSHLEPRDPVASSLSPYFGTKTRYEDVNPVL
LSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARRSRDGGAG
GTGSRDLRAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENCGRLRLI
TSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVE
KNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPI
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLY
HCENAKTPKEQFQVQMLLNEKVLPLAHSQETVSFYEDLKNHYKDILQSCQTSEECELARA
NSTSDEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgcgccccgctgcctcttccggacctccgtagcgcctgccgcggccctggct
gcggcgctgctttcgtcgcttgcgcgctgctctcatctagagccgagggacccggtggcc
tcgtcgctcagcccctatttcggcaccaagactcgctacgaggatgtcaaccccgtgctg
ttgtcgggccccgaagctccttggcgggaccctgagctgctggaggggacctgcaccccg
gtgcagctggtcgccctcattcgccacggcacccgctaccccacggccaaacagatccgc
aagctgaggcagctgcatgggttgctgcaggcccgcaggtccagggatggcggggccggt
ggtaccggcagccgcgacctgcgtgcagcgctggccgactggcctttgtggtacgcggac
tggatggacgggcaactagtagagaagggacggcaggatatgcgacagctggcgctgcgt
ctggcctcgcttttcccggcccttttcagccgtgagaactgcggccgcctgcggctcatc
accagttccaagcaccgctgcatggatagcagcgccgccttcctacaggggctatggcag
cactaccaccctggcttgccgccgcccgacgtcgcagatatggagtttggacctccaaca
gttaatgataaactaatgagattttttgatcactgtgagaagtttttaactgaagtagaa
aaaaatgctacagctctttatcacgtggaagccttcaaaactggaccagaaatgcagaac
attttaaaaaaagttgcagctactttgcaagtgccagtaaatgatttaaatgcagattta
attcaagtagcctttttcacctgttcatttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggtattagaatatttaaatgatctgaaa
caatattggaaaagaggatatgggtatactatcaacagtcgttccagctgcaccttgttt
caggatatctttcagcacttggacaaagcagttgaacagaaacaaaggtctcagccaatt
tcttctccagtcatcctccaatttggtcatgcagagacccttcttccactgctttctctc
atgggctacttcaaagacaaggaacccctaacagcttacaattacaaggaacaaatgcat
cggaagttccgaagcggtcacattgtaccttatgcatcgaacctgatatttgtgctttac
cactgtgaaaatgctaagactcctaaagaacaattccaagtgcagatgttattaaatgaa
aaggtgctacctttggctcactcacaagaaactgtttcattttatgaagatctgaagaac
cactacaaggatatccttcagagttgtcaaaccagtgaagaatgtgaattagcaagggct
aacagtacatctgatgaactatga

DBGET integrated database retrieval system