KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100602648Help
Entry
100602648         CDS       T03265                                 

Gene name
IRAK4
Definition
(RefSeq) interleukin-1 receptor-associated kinase 4 isoform X2
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04010  MAPK signaling pathway
nle04064  NF-kappa B signaling pathway
nle04620  Toll-like receptor signaling pathway
nle04621  NOD-like receptor signaling pathway
nle04722  Neurotrophin signaling pathway
nle05133  Pertussis
nle05135  Yersinia infection
nle05140  Leishmaniasis
nle05142  Chagas disease (American trypanosomiasis)
nle05145  Toxoplasmosis
nle05152  Tuberculosis
nle05161  Hepatitis B
nle05162  Measles
nle05164  Influenza A
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100602648 (IRAK4)
   04064 NF-kappa B signaling pathway
    100602648 (IRAK4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100602648 (IRAK4)
   04621 NOD-like receptor signaling pathway
    100602648 (IRAK4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100602648 (IRAK4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100602648 (IRAK4)
   05133 Pertussis
    100602648 (IRAK4)
   05152 Tuberculosis
    100602648 (IRAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100602648 (IRAK4)
   05162 Measles
    100602648 (IRAK4)
   05164 Influenza A
    100602648 (IRAK4)
   05161 Hepatitis B
    100602648 (IRAK4)
   05168 Herpes simplex virus 1 infection
    100602648 (IRAK4)
   05169 Epstein-Barr virus infection
    100602648 (IRAK4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100602648 (IRAK4)
   05140 Leishmaniasis
    100602648 (IRAK4)
   05142 Chagas disease (American trypanosomiasis)
    100602648 (IRAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100602648 (IRAK4)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100602648 (IRAK4)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: TKL group
  IRAK family
   100602648 (IRAK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal Haspin_kinase Death Focal_AT
Motif
Other DBs
NCBI-GeneID: 100602648
NCBI-ProteinID: XP_003252320
Ensembl: ENSNLEG00000017933
UniProt: G1S8E5
Position
11
AA seq 460 aa AA seqDB search
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAVTV
QQKQMPFYDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacccataacaccatcaacatatgtgcgctgcctcaatgttggactaattagg
aagctgtcagattttattgatcctcaagaaggatggaagaagttagctgtagctattaaa
aaaccatctggtgatgatagatacaatcagtttcacataaggagatttgaagcattactt
caaactggaaaaagtcccacttctgaactactgtttgactggggcaccacaaattgcaca
gttggtgatcttgtggatcttttgatccaaaatgaattttttgctcctgcgagtcttttg
ctcccagatgctgttcccaaaactgctaatacactaccttctaaagaagctgtaacagtt
cagcaaaaacagatgcctttctatgacaaagacaggacattgatgacacctgtgcagaat
cttgaacaaagctatatgccacctgactcctcaagtccagaaaataaaagtttagaagtt
agtgatacacgttttcacagtttttcattttatgaattgaagaatgtcacaaataacttt
gatgaacgacccatttctgttggtggtaataaaatgggagagggaggatttggagttgta
tataaaggctacgtaaataacacaactgtggcagtgaagaagcttgcagcaatggttgac
attactactgaagaactgaaacagcagtttgatcaagaaatcaaagtaatggcaaagtgt
caacatgaaaacttagtagaactacttggtttctcaagtgatggagatgacctctgctta
gtatatgtttacatgcctaatggttcattgctagacagactctcttgcttggatggtact
ccaccactttcttggcacatgagatgcaagattgctcagggtgcagctaatggcatcaat
tttctacatgaaaatcatcatattcatagagatattaaaagtgcaaatatcttactagat
gaagcttttactgctaaaatatctgactttggccttgcacgggcttctgagaagtttgcc
cagacagtcatgactagcagaattgtgggaacaacagcttatatggcacctgaagctttg
cgaggagaaataacacccaaatctgacatttacagctttggtgtggttttactagaaata
ataactggacttccagccgtggatgaacaccgtgaacctcagttattgctagatattaaa
gaagaaattgaagatgaagaaaagacaattgaagattatattgataaaaagatgaatgat
gctgattccacttcagttgaagctatgtactctgttgctagtcaatgtctgcatgaaaag
aaaaataagagaccagacattaagaaggttcaacagctgctgcaagagatgacagcttct
taa

DBGET integrated database retrieval system