KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100603282
Entry
100603282         CDS       T03265                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00230  Purine metabolism
nle01100  Metabolic pathways
nle01522  Endocrine resistance
nle04015  Rap1 signaling pathway
nle04020  Calcium signaling pathway
nle04022  cGMP-PKG signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04072  Phospholipase D signaling pathway
nle04114  Oocyte meiosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04261  Adrenergic signaling in cardiomyocytes
nle04270  Vascular smooth muscle contraction
nle04371  Apelin signaling pathway
nle04540  Gap junction
nle04611  Platelet activation
nle04713  Circadian entrainment
nle04714  Thermogenesis
nle04723  Retrograde endocannabinoid signaling
nle04724  Glutamatergic synapse
nle04725  Cholinergic synapse
nle04727  GABAergic synapse
nle04742  Taste transduction
nle04750  Inflammatory mediator regulation of TRP channels
nle04911  Insulin secretion
nle04912  GnRH signaling pathway
nle04913  Ovarian steroidogenesis
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04916  Melanogenesis
nle04918  Thyroid hormone synthesis
nle04921  Oxytocin signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04925  Aldosterone synthesis and secretion
nle04926  Relaxin signaling pathway
nle04927  Cortisol synthesis and secretion
nle04928  Parathyroid hormone synthesis, secretion and action
nle04934  Cushing syndrome
nle04935  Growth hormone synthesis, secretion and action
nle04970  Salivary secretion
nle04971  Gastric acid secretion
nle04972  Pancreatic secretion
nle04976  Bile secretion
nle05032  Morphine addiction
nle05163  Human cytomegalovirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05200  Pathways in cancer
nle05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100603282 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100603282 (ADCY4)
   04371 Apelin signaling pathway
    100603282 (ADCY4)
   04020 Calcium signaling pathway
    100603282 (ADCY4)
   04072 Phospholipase D signaling pathway
    100603282 (ADCY4)
   04024 cAMP signaling pathway
    100603282 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100603282 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100603282 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100603282 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100603282 (ADCY4)
   04062 Chemokine signaling pathway
    100603282 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100603282 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100603282 (ADCY4)
   04912 GnRH signaling pathway
    100603282 (ADCY4)
   04913 Ovarian steroidogenesis
    100603282 (ADCY4)
   04915 Estrogen signaling pathway
    100603282 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100603282 (ADCY4)
   04921 Oxytocin signaling pathway
    100603282 (ADCY4)
   04926 Relaxin signaling pathway
    100603282 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100603282 (ADCY4)
   04918 Thyroid hormone synthesis
    100603282 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100603282 (ADCY4)
   04916 Melanogenesis
    100603282 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100603282 (ADCY4)
   04927 Cortisol synthesis and secretion
    100603282 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100603282 (ADCY4)
   04270 Vascular smooth muscle contraction
    100603282 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100603282 (ADCY4)
   04971 Gastric acid secretion
    100603282 (ADCY4)
   04972 Pancreatic secretion
    100603282 (ADCY4)
   04976 Bile secretion
    100603282 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100603282 (ADCY4)
   04727 GABAergic synapse
    100603282 (ADCY4)
   04725 Cholinergic synapse
    100603282 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100603282 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100603282 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100603282 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100603282 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100603282 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100603282 (ADCY4)
   04714 Thermogenesis
    100603282 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100603282 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100603282 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100603282 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100603282 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100603282 (ADCY4)
   05163 Human cytomegalovirus infection
    100603282 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100603282 (ADCY4)
Enzymes [BR:nle01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100603282 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 100603282
NCBI-ProteinID: XP_030660009
Ensembl: ENSNLEG00000015446
Position
22a
AA seq 1076 aa
MALFSPRPPPTEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLALAWASGRELTSDPSF
LTTVLCALGGFSLLLGLASREQRLQRWTRPLSSLVWVALLALGYAFLFTGGVVSAWDQVS
YFLFVIFTVYTMLPMGMRDAAVAGLASSLSHLLILGLYLGPQPDSRPALLPQLAANAVLF
LCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKA
EIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNEL
FGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGV
DINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAGA
YAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTRY
LESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSPQWSLDRSRTPRGLDDELDTGDAKF
FQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFII
QMLVTNRPPALAIMYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRPG
LRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPYS
LHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDSR
PGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLL
LENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRL
LNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVE
FAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTG
VLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3231 nt   +upstreamnt  +downstreamnt
atggccctcttcagcccccggccgccccccaccgaagacctcttctacgagacctactac
agcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgtgcgctc
gcggcgctgctcgccttggcctgggccagcggcagggagctgacctcagacccgagcttc
ctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctggcttcccgc
gagcagagactgcagcgctggacgcgtcccctgtccagcttggtatgggtcgcgctgcta
gcgctaggctacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtgtcc
tattttctcttcgtcatcttcacggtgtataccatgctgcccatgggcatgcgggacgcc
gccgtcgcaggcctcgcctcctcactctcgcatctgctgatcctcgggctgtatcttggg
ccacagccggactcacggcctgcactgctgccgcagttggcagcaaacgcggtgctgttc
ctgtgcgggaacgtggcaggagtatatcacaaggcgctgatggagcgcgccctgcgggcc
acgttccgggaggcactcagctccctgcactcacgccggcggctggacaccgagaagaag
caccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaaggca
gagatcatggcacggctgcaggcaggacagggttcacggccagagagcaccaacaatttc
cacagcctctatgtcaagaggcaccagggagtcagcgtgctatatgctgacatcgtgggc
ttcacgcggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgagctc
tttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctgggg
gactgttactactgtgtctccgggctgccactctcactgccagaccacgccatcaactgc
gtgcgcatggggctggacatgtgccgggccatcaggaaactgcgggcagccactggcgtg
gacatcaacatgcgtgtgggcgtgcactcaggcagcgtactgtgtggagtcatcgggctg
cagaagtggcagtacgacgtttggtcccatgatgtcacactggctaaccacatggaggca
ggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcaggggct
tatgctgtggaggacgcgggcatggagcatcgggacccctaccttcgggagctaggggag
cctacctatctggtcatcgatccacgggcagaggaggaggatgagaagggcactgcagga
ggcttgctgtcctcgcttgagggcctcaagatgcgtccatcactgctgatgacccgttac
ctggagtcctggggtgcagccaagccttttgcccacctgagccacggagacagccctgtg
tccacctccacccctctcccggagaagaccctggcttccttcagcccccagtggagcctg
gatcggagccgtaccccccggggactagatgatgaactggacactggggatgccaagttc
ttccaggtcattgagcagctcaactcgcagaaacagtggaagcagtctaaggacttcaac
ccactgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgcaatc
cccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatcatc
cagatgctagtgacaaacaggcccccagctctggccatcatgtatagcatcaccttcctc
ctcttcctcctcatcctttttgtctgcttctcagaggacctgatgaggtgtgtcctgaaa
ggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacacgaccagga
ctgagaatagccttgggcaccgccaccatcctccttgtctttgccatggccattaccagc
ctgttcttcttcccaacatcatcagactgccctttccaagctcccaatgtgtcctccatg
atttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatactcc
ctgcactgctgcacactgggcttcctctcctgctccctctttctgcacatgagcttcgag
ctgaagctgctgctgctcctgctgtggctggcggcatcctgctccctcttcctgcactcc
cacgcctggctgtccgaatgcctcatcgtccgcctctatctgggccccttggactccagg
cccggagtgctgaaggagcccaaactgatgggtgctatctccttcttcatcttcttcttc
accctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtggaag
aagaagctgaggcaggagcgggaggagacagagacgatggagaacctgactcggctgctc
ttggagaatgtgctccctgcacacgtggccccccagttcattggccagaaccggcgcaac
gaggatctctaccaccagtcctacgaatgcgtttgtgtcctcttcgcctcagtcccagac
ttcaaggagttctactctgaatccaacatcaatcatgagggcctagagtgtctgaggctg
ctcaatgagataattgctgattttgatgagctgctttccaagcccaagttcagtggggtg
gagaagatcaagaccatcggcagcacctacatggcagccacaggcttaaatgccacctct
ggacaggatgcacaacaggatgctgaacggagctgcagccaccttggcactatggtggaa
tttgccgtggccctggggtctaagctggacgtcatcaacaagcattcattcaacaacttc
cgcctgcgtgtggggttgaaccatggaccagtagtagctggagttattggggcccagaag
ccgcaatatgacatttggggcaacacagtgaatgtggccagccgcatggagagtacagga
gtccttggcaaaatccaagtgactgaggagacagcatgggccctacagtccctgggctac
acctgctacagccggggtgtcatcaaggtgaaaggcaaagggcagctctgcacctacttc
ctgaacacagacttgacacgaactggacctccttcagctaccctgggctga

DBGET integrated database retrieval system