KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100603432Help
Entry
100603432         CDS       T03265                                 

Gene name
PCBD2
Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase 2
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00790  Folate biosynthesis
nle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100603432 (PCBD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100603432 (PCBD2)
Enzymes [BR:nle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     100603432 (PCBD2)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100603432 (PCBD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 100603432
NCBI-ProteinID: XP_003266446
Ensembl: ENSNLEG00000028354
UniProt: A0A2I3H4V4
Position
2
AA seq 130 aa AA seqDB search
MAAVIGARGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDA
IYKEFSFHNFNQAFGFMSQVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA
KFIEKAAASV
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgatcggggcgcggggggcgacgcggcgcttgttggctgcgctgcgaggc
cagagcctagggctcgcggccatgtcatcaggtactcacaggttgactgcagaggagagg
aaccaagctatacttgaccttaaagcagcaggatggtcggaattaagtgagagagatgcc
atctacaaagaattctccttccacaattttaatcaggcatttggctttatgtcccaagtt
gccctacaagcagagaagatgaatcatcacccagaatggttcaatgtatacaacaaggtc
cagataactctcacctcacatgactgtggtgaactgaccaaaaaagatgtgaagctggcc
aagtttattgaaaaagcagctgcttctgtgtga

DBGET integrated database retrieval system