KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100603829Help
Entry
100603829         CDS       T03265                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:nle00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100603829 (ABHD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nle01002]
    100603829 (ABHD6)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100603829 (ABHD6)
Peptidases [BR:nle01002]
 Serine Peptidases
  Family S33
   100603829 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr BAAT_C DLH DUF1057 FSH1 Thioesterase
Motif
Other DBs
NCBI-GeneID: 100603829
NCBI-ProteinID: XP_003257278
UniProt: A0A2I3HK60
Position
4
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFVQRLKELQDSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKAPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgatgtggttaacatgtttgtgattgcgggcgggacgctggccatcccaatc
ctggcattcgtggcttcatttcttctgtggccttcagcactgataagaatctattattgg
tactggcggaggacattgggcatgcaagtccgctatgttcaccatgaagactatcagttc
tgttattccttccggggcaggcctgggcacaaaccctccatcctcatgctccacggattc
tctgcccacaaggatatgtggctcagtgtggtcaagttccttccaaagaacctgcacttg
gtctgcgtggacatgccaggacatgagggcaccacccgctcctccctggatgacctgtcc
atagatgggcaagttaagaggatacaccagtttgtagaatgcctgaagctgaacaaaaaa
cctttccacctggtaggcacctccatgggtggccaggtggctggggtgtatgctgcttac
tacccatcggatgtctccagcctgtgtcttgtgtgtcctgctggcctgcagtactcaact
gacaatcaattcgtacaacggctcaaagaactgcaggactctgccgccgtggagaagatt
cccttgatcccgtctaccccagaagagatgagtgaaatgcttcagctctgctcctatgtc
cgcttcaaggtgccccagcagatcctgcaaggccttgtcgatgtccgcatacctcataac
aacttctaccgaaagctgtttttggaaatcgtcagtgagaagtccagatactctctccat
cagaacatggacaagatcaaggctccaacgcagatcatctgggggaaacaagaccaggtg
ctagatgtgtctggggcagacatgttggccaagtcaattgccaactgccaggtggagctt
ctggaaaactgtgggcactcggtagtgatggagagacccaggaagacagccaagctcata
atcgactttttagcttctgtgcacaacacagacaacaacaagaagctggactga

DBGET integrated database retrieval system