KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100603886Help
Entry
100603886         CDS       T03265                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04015  Rap1 signaling pathway
nle04115  p53 signaling pathway
nle04145  Phagosome
nle04151  PI3K-Akt signaling pathway
nle04350  TGF-beta signaling pathway
nle04510  Focal adhesion
nle04512  ECM-receptor interaction
nle05144  Malaria
nle05165  Human papillomavirus infection
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100603886 (THBS1)
   04350 TGF-beta signaling pathway
    100603886 (THBS1)
   04151 PI3K-Akt signaling pathway
    100603886 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100603886 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100603886 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100603886 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100603886 (THBS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100603886 (THBS1)
   05205 Proteoglycans in cancer
    100603886 (THBS1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100603886 (THBS1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100603886 (THBS1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100603886 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100603886 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100603886 (THBS1)
Membrane trafficking [BR:nle04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100603886 (THBS1)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   100603886 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC EGF_3 EGF_CA Laminin_G_3 cEGF Laminin_G_2 EGF Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 100603886
NCBI-ProteinID: XP_003266759
UniProt: G1QNM9
Position
6
AA seq 1170 aa AA seqDB search
MGLAWGLGILFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
IHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGQGVEYATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctggggactaggcatcctgttcctgatgcatgtgtgtggcaccaaccgc
attccagagtctgggggagacaacagcgtatttgacatctttgaactcaccggggccgcc
cgcaaggggtctgggcgccgactggtgaagggccccgacccttccagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgatgacaagttccaagacctggtggat
gctgtgcgggcagaaaagggtttcctccttctggcctccctgaggcagatgaagaagacc
cggggcacgctgctggccctggagcggaaagaccactctggccaggtcttcagcgtggtg
tccaacggcaaggcgggcaccctggacctcagcctgaccgtccaaggaaagcagcacgtg
gtgtctgtggaagaagctctcctggcaaccggccagtggaagagcatcaccctgtttgtg
caggaagacagggcccagctgtacatcgattgtgaaaagatggagaatgctgagttggac
gtccccatccaaagcgtcttcaccagagacctggccagcatcgccagactccgcatcgca
aaggggggcgtcaatgacaatttccagggggtgctgcagaatgtgaggtttgtctttgga
accacaccagaagacatcctcaggaacaaaggctgctccagctctaccagtgtcctcctc
acccttgacaacaacgtggtgaatggttccagccctgccatccgcactaactacattggc
cacaagacaaaggacttgcaagccatctgcggcatctcctgtgatgagctgtccagcatg
gtcctggaactcaggggcctgcgcaccattgtcaccacgctgcaggacagcatccgcaaa
gtgactgaagagaacaaagagttggccaatgagctgaggcggcctcccctgtgctatcac
aatggagttcagtacagaaacaacgaggaatggactgttgatagctgcactgagtgtcgc
tgtcagaactcagttaccatctgcaaaaaggtgtcctgccccatcatgccctgttccaat
gccacagttcctgatggagaatgctgccctcgctgttggcccagcgactctgcggacgat
ggctggtctccgtggtctgagtggacctcctgttctacgagctgtggcaatggaattcag
cagcgcggccgctcctgcgatagtctcaacaaccgatgcgagggctcctcggtccagaca
cggacctgccacattcaagagtgtgacaagagatttaaacaggatggtggctggagccac
tggtccccgtggtcatcttgttctgtgacatgtggtgatggtgtgatcacaaggatccgg
ctctgcaactctcccagcccccagatgaatgggaaaccctgtgaaggcgaagcgcgggag
accaaagcctgcaagaaagatgcctgccccatcaatggaggctggggtccttggtcacca
tgggacatctgttctgtcacctgtggaggaggggtacagaaacgtagccggctctgcaac
aaccccacaccccagtttggaggcaaggactgcgttggtgatgtgacagaaaaccagatc
tgcaacaagcaggactgtccaattgatggatgcctgtccaatccctgctttgccggcgtg
aagtgtactagctaccctgatggcagctggaaatgtggtgcttgtccccctggttacagt
ggaaatggcatccagtgcacagatgttgatgagtgcaaagaagtgcctgacgcctgcttc
atccacaatggagagcacaggtgtaagaacacggaccccggctacaactgcctgccctgc
cccccacgcttcaccggctcacagcccttcggccagggcgtcgaatatgccacggccaac
aagcaggtgtgcaagccccgtaacccctgcacggatgggacccacgactgcaacaagaac
gccaagtgcaactacctgggccactatagcgaccccatgtaccgctgcgagtgcaagcct
ggctacgctggcaatggcatcatctgtggggaggacacagacctggatggctggcccaat
gagaacctggtgtgcgtggccaatgcgacttaccactgcaaaaaggataattgccccaac
ctccccaactcagggcaggaagactatgacaaggatggaattggtgatgcctgtgatgat
gacgatgacaatgataaaattccagatgacagggacaactgtccattccattacaaccca
gctcagtatgactatgacagagatgatgtgggagaccgctgtgacaactgtccctacaac
cacaacccagatcaggcagacacagacaacaatggggaaggagacgcctgtgctgcagac
attgatggagacggtatcctcaatgaacgggacaactgccagtatgtctacaatgtggat
cagagagacactgatatggatggggttggagatcagtgtgacaactgccccttggaacac
aatccggatcagctggactctgactcagaccgcattggagatacctgtgacaacaatcag
gatattgatgaagatggccaccagaacaatctggacaactgtccctatgtgcccaatgcc
aaccaggctgaccatgacaaagatggcaagggagatgcctgtgaccacgatgatgacaac
gatggcattcctgatgacagggacaactgcagactcgtgcccaatcccgaccagaaggac
tctgatggcgatggtcgaggtgatgcttgcaaagatgattttgaccatgacagtgtgcca
gacatcgatgacatctgtcctgagaatgttgacatcagtgagaccgatttccgccgattc
cagatgattcctctggatcccaaagggacatcccaaaatgaccctaactgggttgtacgc
catcagggtaaagaactcgtccagactgtcaactgtgatcctggactcgctgtaggtttt
gacgagtttaatgctgtggacttcagtggcaccttcttcatcaacaccgaaagggatgat
gactatgctgggtttgtctttggctaccagtccagcagccgcttttatgttgtgatgtgg
aagcaagtcacccagtcctactgggacaccaaccccacgagggctcagggatactcgggc
ctttctgtgaaagttgttaactccaccacagggcctggcgagcacctgcggaacgccctg
tggcacacaggaaacacccctggccaggtgcgcaccctgtggcatgaccctcgtcacata
ggctggaaagatttcaccgcctacagatggcgtctcagccacaggccaaagacgggtttc
attagagtggtgatgtatgaagggaagaaaatcatggctgactcaggacccatctatgat
aaaacctatgctggtggtagactagggttgtttgtcttctctcaagaaatggtgttcttc
tccgacctgaaatacgaatgtagagatccctaa

DBGET integrated database retrieval system