KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100603955Help
Entry
100603955         CDS       T03265                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nle01002]
    100603955 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100603955 (ABHD12)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100603955 (ABHD12)
Peptidases [BR:nle01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100603955 (ABHD12)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100603955 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Peptidase_S15 Say1_Mug180 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 100603955
NCBI-ProteinID: XP_003278551
UniProt: A0A2I3I0A3
Position
13
AA seq 336 aa AA seqDB search
MRRKGLWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGL
NHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRG
GDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYI
WGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFL
DPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFHLGRKLYSIAAPARSFRDFKVQFV
PFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgaaagggcctgtggttgcgcctgaggaagatacttttctgtgttttggggttg
tacattgccattccatttctcatcaaactatgtcctggaatacaggccaaactgattttc
ttgaatttcgtaagggttccctatttcattgatttgaaaaaaccacaggatcaaggtttg
aatcacacgtgtaactactacctgcagccagaggaagatgtgaccattggagtctggcac
accgtccctgcagtctggtggaagaacgcccaaggcaaagaccagatgtggtatgaggat
gccttggcttccagtcaccctatcattctgtacctgcatgggaacgcaggtaccagagga
ggcgaccaccgcgtggagctttacaaggtgctgagttcccttggttaccatgtggtcacc
tttgactacagaggttggggtgactcggtgggaacaccatctgagcggggcatgacctat
gacgcactccacgtttttgactggatcaaagcaagaagtggtgacaaccccgtgtacatc
tggggccactctctgggcactggtgtggcgacaaatctagtgcggcgcctctgtgagcga
gagacgcctccagatgcccttatattggaatctccattcactaatatccgcgaagaagct
aagagccatccattttcagtgatatatcgatacttccctgggtttgactggttcttcctt
gatcctattacaagcagtggaattaaatttgcaaatgatgaaaatgtgaagcacatctcc
tgtcccctgctcatcctgcacgctgaggacgacccggtggtgcccttccatcttggcaga
aagctctatagcatcgccgcaccagctcgaagcttccgagacttcaaagttcagtttgtg
ccctttcattcagaccttggctacaggcacaaatacatttacaagagccctgagctgcca
cggatactgagggaattcctggggaagtcggagcctgagcaccagcactga

DBGET integrated database retrieval system