KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100604936Help
Entry
100604936         CDS       T03265                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04024  cAMP signaling pathway
nle04080  Neuroactive ligand-receptor interaction
nle04713  Circadian entrainment
nle04720  Long-term potentiation
nle04723  Retrograde endocannabinoid signaling
nle04724  Glutamatergic synapse
nle04728  Dopaminergic synapse
nle04730  Long-term depression
nle05014  Amyotrophic lateral sclerosis (ALS)
nle05031  Amphetamine addiction
nle05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100604936 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100604936 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100604936 (GRIA1)
   04728 Dopaminergic synapse
    100604936 (GRIA1)
   04720 Long-term potentiation
    100604936 (GRIA1)
   04730 Long-term depression
    100604936 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    100604936 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100604936 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100604936 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100604936 (GRIA1)
   05033 Nicotine addiction
    100604936 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nle04040]
    100604936 (GRIA1)
Ion channels [BR:nle04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100604936 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 100604936
NCBI-ProteinID: XP_003276601
Ensembl: ENSNLEG00000016504
Position
2
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGREQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgct
gcttttagatttgctttgtcgcaactcacagagcccccgaagctgctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctccaaa
ggagtctatgccatctttgggttttatgaacgtaggactgtcaacatgctgacctccttt
tgtggggccctccatgtctgcttcattacaccgagctttcccgttgatacatccaatcag
tttgtccttcagctgcgccctgaactgcaggatgccctcatcagcatcattgaccattac
aagtggcagaaatttgtctacatttatgatgccgaccggggcttatccgtcctgcagaaa
gtcctggacacagctgccgagaagaactggcaggtgacagcagtcaacattttgacaacc
acagaggagggataccggatgctctttcaggacttggagaagaaaaaggagcggctggtg
gtggtggactgtgaatcagaacgcctcaatgctatcttgggccagattataaagctggag
aagaatggcatcggctaccactacattcttgcaaatctgggcttcatggacattgattta
aacaaattcaaggagagtggtgccaatgtgacaggtttccaactggtgaactacacagac
actattccagccaagatcatgcagcagtggaagaatagtgacgctcgagaccacacacgg
gtggactggaagagacccaagtacacctctgcgctcacctatgatggggtgaaggtgatg
gctgaggctttccagagcctgcggaggcagagaattgatatatctcgccgggggaatgct
ggggattgtctggctaacccagctgttccctggggccaagggatcgacatccagagagct
ctgcagcaggtgcgatttgaaggtttgacaggaaacgtgcagtttaatgagaaaggacgc
cggaccaactacacgctccacgtgattgaaatgaaacatgatggcatccgaaagataggt
tactggaatgaagatgataagtttgtccctgcagccaccgatgcccaagctgggggcgat
aattcaagtgttcagaacagaacatacatcgtcacaacaatcctagaagatccttatgtg
atgctcaagaagaacgccaatcagtttgagggcaatgaccgttacgagggctactgtgta
gagctggcggcagagattgccaagcacgtgggctactcctaccgtctggagattgtcagt
gatggaaaatatggagcccgagaccctgacacgaaggcctggaatggcatggtgggagag
ctggtctatggaagagcagatgtagctgtggctcccttaactatcactttggtccgggaa
gaagttatagatttctccaaaccatttatgagtttggggatctccatcatgattaaaaaa
ccacagaaatccaagccgggtgtcttctccttccttgatcctttggcttatgagatttgg
atgtgcattgtttttgcctacattggagtgagtgttgtcctcttcctggtcagccgcttc
agtccctatgaatggcacagtgaagagtttgaggaaggacgggagcagacaaccagtgac
cagtccaatgaatttgggatattcaacagtctgtggttctccctgggagccttcatgcag
caaggatgcgacatttctcccaggtccctgtctggtcgcatcgttggtggcgtctggtgg
ttcttcaccttaatcatcatctcctcatatacagccaatctggccgccttcctgaccgtg
gagaggatggtgtctcccattgagagtgcagaggacctagcgaagcagacagaaattgcc
tacgggacgctggaagcaggatctactaaggagttcttcaggaggtctaaaattgccgtg
tttgagaagatgtggacatacatgaagtcagcagagccatcagtttttgtgcggaccaca
gaggaggggatgattcgagtgaggaaatccaaaggcaaatatgcctacctcctggagtcc
accatgaatgagtacattgagcagcggaaaccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcaacaccgaaggggtctgccctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacaagcgct
ctgagcctcagcaatgtggcaggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagtgaatccaagcggatgaag
ggtttttgtttgatcccacagcaatccatcaacgaagccatacggacatcgaccctcccc
cgcaacagcggggcaggagccagcagcggcggcagtggagagaatggtcgggtggtcagc
catgacttccccaagtccatgcaatcgattccttgcatgagccacagttcagggatgccc
ttgggagccacgggattgtaa

DBGET integrated database retrieval system