KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100605354Help
Entry
100605354         CDS       T03265                                 

Gene name
PIGT
Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
nle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    100605354 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 100605354
NCBI-ProteinID: XP_030681472
Ensembl: ENSNLEG00000006720
Position
13
AA seq 578 aa AA seqDB search
MAAALPLALFVLLLLGPGGWCLAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDKSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANDTDHYFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSISWELRQ
TLSVVFDAFITGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITNYNQDNETLEVHPPP
TTTYQDVILGTRKTYAIYDLLDTAMINNSRNLNIQLKWKRPPENEAPPVPFLHAQRYVSG
YGLQKGELSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQ
DRLQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVA
AKPVDWEESPLFNSLFPVSDGSNYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPRTGGLAKRLANLIRRARGVPPL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgctttgccgcttgctctgttcgtcctgctgctcctggggcccggcggctgg
tgccttgcagaacccccacgcgacagcctgcgggaggaacttgtcatcaccccgctgcct
tccggggacgtagccgccacattccagttccgcacgcgctgggattcggagcttcagcgg
gaaggagtgtctcattacaggctctttcccaaagccctggggcagctgatctccaagtat
tctctacgggagctgcacctgtcattcacacaaggcttttggaggacccgatactggggg
ccacccttcctgcaggccccatcgggtgcagagctctgggtctggttccaagacactgtc
actgatgtggataaatcttggaaggagctcagtaatgtcctctcagggatcttctgcgcc
tctctcaacttcatcgactccaccaacacggtcactcccactgcctccttcaaacccctg
ggtctggccaatgacactgaccactactttctgcgctatgctgtgctgccacgggaggtg
gtctgcactgaaaacctcaccccctggaagaagctcttgccctgtagttccaaggcaggc
ctctctgtgctgctgaaggcggatcgcttgttccacaccagctaccactcccaggcagtg
catattcgccctgtttgcagaaatgcacgctgtactagcatctcctgggagctgaggcag
accctgtcagttgtatttgatgccttcatcacggggcaggggaagaaagactggtccctc
ttccggatgttctcccgaaccctcacggagccctgccccctggcttcagagagtcgagtc
tatgtggacatcaccaactacaaccaggacaatgagacattagaggtgcacccacccccg
accactacctatcaggatgtcatcctaggcactcggaagacctatgccatctatgacttg
cttgacaccgccatgatcaacaactctcgaaacctcaacatccagctcaagtggaagaga
cccccagagaatgaggcccctccagtgcccttcctgcatgcccagcggtacgtgagcggc
tatgggctgcagaagggggagctgagcacactgctatacaacacccacccataccgggcc
ttcccggtgctgctgctggacaccgtaccctggtatctgcggctgtatgtgcacaccctc
accatcacctccaagggcaaggagaacaaaccaagttacatccactaccagcctgcccag
gaccggctgcaaccccacctcctggagatgctgattcagctgccagccaactcagtcacc
aaggtttccattcagtttgagcgggcgctgctgaagtggactgagtacacgccagatcct
aaccatggcttctatgtcagcccatctgtcctcagcgcccttgtgcccagcatggtagca
gccaagccagtggactgggaagagagtcccctcttcaacagcctgttcccagtctctgat
ggctctaactacttcgtgcggctctacacggagccgctgctggtgaacctgccgacaccg
gacttcagcatgccctacaacgtgatctgcctcacgtgcactgtggtggccgtgtgctac
ggctccttctacaatctcctcacccgaaccttccacattgaggagccccgcacgggcggc
ctggccaagcggctggccaaccttatccggcgcgcccgaggtgtccccccactctga

DBGET integrated database retrieval system