KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100607511Help
Entry
100607511         CDS       T03265                                 

Gene name
RASSF5
Definition
(RefSeq) Ras association domain family member 5
  KO
K08015  Ras association domain-containing protein 5
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04218  Cellular senescence
nle04670  Leukocyte transendothelial migration
nle05200  Pathways in cancer
nle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100607511 (RASSF5)
   04015 Rap1 signaling pathway
    100607511 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100607511 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100607511 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100607511 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100607511 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Motif
Other DBs
NCBI-GeneID: 100607511
NCBI-ProteinID: XP_012362223
UniProt: G1QIK8
Position
5
AA seq 418 aa AA seqDB search
MAMASPAIGQRPYPLLLDPEPPRYLQSLSGSEPPPPPPDRSSRLCVPAPLSTAPGAREGR
SARRAARGNLEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHCFAELVLPGGPGWCDLCGREVLRQALRCANCKFTCHPECRSLIQLDCSQQEGLSRDR
PSPESTLTLTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLRKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcgtccccggccatcgggcagcgcccgtacccgctactcttggaccccgag
ccaccgcgctatctacagagcctgagcggctccgagccgccgccgccgccccccgaccgg
tcctcgcgcctctgtgtcccggcgcccctctccactgcgcccggggcgcgcgaggggcgc
agcgcccggagggctgcccgggggaacctcgagcccccgccccgggcctcccgacccgct
cgcccgctccggcctggtctgcagcagagactgcggcggcggcctggagcgccccgaccc
cgcgacgtgcggagcatcttcgagcagccgcaggatcccagagtcccagcggagcgaggc
gaggggcactgcttcgccgagttggtgctgccgggcggccccggctggtgtgacctgtgc
ggacgagaggtgctgcggcaggcgctgcgctgcgctaactgtaaattcacctgtcaccca
gaatgccgcagcctgatccagttggactgcagtcagcaggagggtttatcccgggacaga
ccctctccagaaagcaccctcaccctgaccttcagccagaatgtctgtaaacctgtggag
gagacacagcgcccacccacactgcaggagatcaagcagaagatcgacagctacaacacg
cgagagaagaactgcctgggcatgaaactgagtgaagatggcacctacacgggtttcatc
aaagtgcatctgaaactccggcggcctgtgacggtgcctgctgggatccggccccagtcc
atctatgatgccatcaaggaggtgaacctggcagctaccacggacaagcggacatccttc
tacctgcccctagatgccatcaagcagctgcacatcagcagcaccaccaccgtcagtgag
gtcatccaggggctgctcaggaagttcatggttgtggacaatccccagaagtttgcactt
tttaagcggatacacaaggacggacaagtgctcttccagaaactctccattgctgaccgc
cccctctacctgcgcctgcttgctgggcctgacacggaggtcctcagctttgtgctaaag
gagaatgaaactggagaggtggagtgggatgccttctccatccctgaacttcagaacttc
ctaacaatcctggaaaaagaggagcaggacaaaatccaacaagtgcaaaagaagtatgac
aagtttaggcagaaactggaggaggccttaagagaatcccagggcaaacctgggtaa

DBGET integrated database retrieval system