KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 101178708Help
Entry
101178708         CDS       T03265                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00561  Glycerolipid metabolism
nle01100  Metabolic pathways
nle04714  Thermogenesis
nle04723  Retrograde endocannabinoid signaling
nle04923  Regulation of lipolysis in adipocytes
Module
nle_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:nle00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101178708
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101178708
  Nervous system
   04723 Retrograde endocannabinoid signaling
    101178708
  Environmental adaptation
   04714 Thermogenesis
    101178708
Enzymes [BR:nle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101178708
Peptidases [BR:nle01002]
 Serine Peptidases
  Family S33
   101178708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 101178708
NCBI-ProteinID: XP_004091794
Position
21
AA seq 100 aa AA seqDB search
METGPEDPSRMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYEELARMLMGLDLLVFAHDHGECPRVLSELARP
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacctgaagacccttccagaatgccagaggaaagttcccccaggcggacc
ccgcagagcattccctaccaggaccttcctcacctggtcaatgcagacggacagtacctc
ttctgcaggtactggaaacccacaggcacacccaaggccctcatctttgtgtcccatgga
gccggagagcactgtggccgctatgaagagctggctcggatgctgatggggctggacctg
ctggtgttcgcccatgaccacggtgagtgtcccagggtgctgtcagagctggccaggccc
tga

DBGET integrated database retrieval system