KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0347Help
Entry
NMA0347           CDS       T00031                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:nma00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMA0347
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nma01007]
    NMA0347
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nma03016]
    NMA0347
Enzymes [BR:nma01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     NMA0347
Amino acid related enzymes [BR:nma01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   NMA0347
Transfer RNA biogenesis [BR:nma03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    NMA0347
 Prokaryotic Type
    NMA0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 PARP_reg
Motif
Other DBs
NCBI-ProteinID: CAM07647
UniProt: Q9JWJ3
Position
322855..324954
Genome map
AA seq 699 aa AA seqDB search
MTTITEKRLTFAFPEDYYVTKYDEWEHYKIFQNSCNLRNKIDTNEKGKNGINQSVDDDNG
SSGVDIIALHESTLWLIEIKDYYRLGLEPNAQSIDEKLSDLPYLIARKIRDSLAGLVSAK
FKAEKQEEKDFSRLALDCNEIKIVLHIEMPSIRSKLYPSSSDLANLLKDKFKLSEFTKNF
ANCYAEPIFTNISHINNPQLRNVPWSVSTGTEQKLSSEQQRLIHNPMTTIYNTLTRQKEP
FAPIDPKNVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLRECGYPLTYVRNITDIDDKI
IARAAENGETIGELTARFIQAMHEDADALGVLRPDIEPKATENIPQMIAMIETLIQNGKA
YPAANGDVYYAVREFSAYGQLSGKSLDDLRAGERVEVDGFKRDPLDFVLWKAAKAGEPAW
ESPWGNGRPGWHIECSAMSENLFGNTFDIHGGGADLQFPHHENEIAQSVGATGHTCGHHH
AQTHHGQSIASHVKYWLHNGFIRVDGEKMSKSLGNFFTIREVLKQYDPEVVRFFILRAHY
RSPLNYSDAHLDDAKGALTRLYTTLKNTPAAEFDLSENVNDYTRRFYAAMNDDFGTVEAV
AVLFELAGEVNKTNDAQLAGCLKALGGIIGLLQRDPTEFLQGGAASDGLSNEEIEDLIAR
RKQARADKNWAESDRIRDLLNEHKIILEDNAGGTTWRRG
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgactacaatcacagaaaagagattaacctttgcttttcctgaagattattacgttacc
aagtatgacgaatgggaacattataaaatttttcagaacagttgtaatttacgtaataaa
attgatacaaatgaaaagggaaagaacgggataaatcaaagtgtagatgacgataatggc
agctcaggtgtagatataatagcccttcatgagtcgacactttggctaatcgaaattaaa
gattattaccgacttgggcttgagccaaatgcccaatcaatagatgaaaaactttctgac
ctaccatatttaatcgcaagaaaaattcgagattcattggcaggattggtttctgctaaa
tttaaagcagaaaaacaggaagaaaaagatttttctcgcttggctttagattgtaacgaa
ataaaaatagtccttcatattgaaatgcctagtataagaagtaaactttatccctcgtca
tcagatttagcaaacttattaaaagataagtttaaattatcagaatttacaaaaaatttt
gcaaactgttatgcagaaccaattttcacaaatatcagccatattaataatccgcaacta
cgtaatgttccttggtccgtatctacaggaacagaacagaaattatcatccgagcaacaa
agattaatccataatcccatgaccaccatctacaacacccttacccgccaaaaagaaccc
tttgcccccatcgaccctaaaaacgtgcgtatgtacgtttgcggcatgactgtttacgac
tattgccacttaggccatgcccgtgtgatggtggtgtttgacatgattgcccgctggttg
cgcgagtgcggttatccgctcacttatgtgcgcaacatcaccgacatcgacgacaaaatc
attgcccgcgcggctgaaaacggcgagactatcggcgaactgaccgcgcgtttcattcag
gcgatgcacgaagatgccgatgctttgggcgtgttgcgtccggacatcgaaccgaaggca
acggaaaacatcccgcaaatgattgccatgattgaaaccctgattcaaaacggtaaggcc
tatcctgccgcaaacggcgacgtttactacgccgtgcgcgagttttccgcttacggacaa
ttatcgggcaaatcattggacgacctgcgcgcgggcgaacgtgtggaagtggacggtttc
aaacgcgatccgcttgattttgtgttgtggaaagcggcgaaagcaggcgagccggcgtgg
gaaagcccttggggcaacggccggccgggttggcacattgaatgctccgccatgagtgaa
aacctgttcggcaataccttcgacatccacggcggcggcgcggatttgcagtttccgcac
cacgaaaacgaaattgcccaaagcgtcggcgcgacggggcatacctgcggccatcatcac
gcgcaaacccaccacggtcaaagcattgccagccacgtcaaatactggttgcacaacggc
tttatccgcgtggacggcgaaaaaatgtccaaatcgttgggcaacttcttcactatccgc
gaagtgttgaaacaatacgaccccgaagtcgtgcgtttcttcatcctgcgcgcccactac
cgcagcccgttgaattactccgacgcacatttggacgacgcaaaaggtgcgctgacccgc
ctgtacactacattgaaaaacacaccagcggctgagtttgacttatctgaaaacgtcaac
gactacacccgccgtttctacgccgccatgaacgacgattttggtacggtcgaagcggtt
gccgtgttgttcgaactggcaggcgaagtgaacaaaaccaatgacgcacagctcgccggc
tgcctgaaagccttgggcggcatcatcggactgctgcaacgcgatccgaccgagttcctg
caaggcggcgcggcttcagacggtctctccaacgaagaaatcgaagacttgatcgcccgg
cggaaacaggcgcgcgccgataaaaactgggcggaatccgaccgcatccgcgaccttctg
aacgaacacaaaatcattttggaagacaacgccggcggcacgacttggcggcgcggttaa

DBGET integrated database retrieval system