KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0635Help
Entry
NMA0635           CDS       T00031                                 

Definition
(GenBank) hypothetical protein NMA0635
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Brite
KEGG Orthology (KO) [BR:nma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NMA0635
Enzymes [BR:nma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     NMA0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP PHA_gran_rgn
Motif
Other DBs
NCBI-ProteinID: CAM07900
UniProt: A0A0U1RHN2
Position
619076..619912
Genome map
AA seq 278 aa AA seqDB search
MIDLHCHSTVSDGMLSPAEVVRLAHQNGCTLLALTDHDHTGGIAEARAEADRLGLRLING
VEISVTWRGRTIHVVGLDFDERDENLQNLLAQVRQGRLKRLEAIAAKLEKKGIGGAYDGA
LALAANKEMVSRTHVAEFLIQAGHVKNKQQAFIKYLGDGKSCAVRHEWATLEDCVSAVNG
AGGMAVIAHPMRYDLSATAKRNLFEEFKNLGGAGIEVHSGNCCKNDRLNYALLAERFGML
ASAGSDFHRLNDFSGGILGACPELPENCRPVWAHFSRH
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatagacctgcactgccattccaccgtttccgacggtatgctttcccccgccgaagtc
gtccgcctcgcgcatcaaaacggctgcacgctgctggcgttgaccgaccacgaccatacc
ggcggcatcgccgaagcgcgtgccgaagccgacaggctcggtttgcgcctgattaacggt
gtggaaatctccgtaacgtggcgcgggcgtaccatacacgttgtcggtttggatttcgac
gaacgggacgaaaacctgcaaaacctgttggcgcaagtgcggcaaggccgtctgaaacgc
ctcgaagccatcgccgccaagctcgaaaagaaaggcatcggcggcgcatacgacggcgcg
ctggcactggcggcaaacaaagaaatggtcagccgcacccacgtcgccgagttcctcatc
caagcgggacatgtcaaaaacaagcagcaggcgttcatcaaatacttgggcgacggcaaa
tcctgcgctgtccgccacgaatgggcgacgctggaagactgcgtctccgccgtcaacggc
gcgggcggcatggcagtcatcgcccaccccatgcgctacgatttgtccgccaccgccaag
cgcaatctgtttgaagaatttaaaaacctcggcggcgcaggcatcgaagtccacagcggc
aactgctgcaaaaacgaccgcctcaactacgcgcttttggcagaacgtttcggtatgctc
gccagcgcgggcagcgacttccaccgtttaaacgacttcagcggcggcatcctcggcgcg
tgtcccgagctgccggaaaactgtaggccggtgtgggcgcatttttcccgacattga

DBGET integrated database retrieval system