KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0848Help
Entry
NMA0848           CDS       T00031                                 

Definition
(GenBank) putative UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00040  Pentose and glucuronate interconversions
nma00052  Galactose metabolism
nma00500  Starch and sucrose metabolism
nma00520  Amino sugar and nucleotide sugar metabolism
nma01100  Metabolic pathways
nma01130  Biosynthesis of antibiotics
Module
nma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NMA0848
   00052 Galactose metabolism
    NMA0848
   00500 Starch and sucrose metabolism
    NMA0848
   00520 Amino sugar and nucleotide sugar metabolism
    NMA0848
Enzymes [BR:nma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NMA0848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: CAM08085
UniProt: A0A0U1RI12
Position
complement(828738..829607)
Genome map
AA seq 289 aa AA seqDB search
MKPIRKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRN
KRSIEDHFDKAYELETELEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARA
AIGDEPFAVILADDLIDAQKGALKQMVEVYERSGNSILGVETVEPSQTGSYGIVETEQLK
QFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPRGAGNEIQLTDGIAKLLDH
EFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRRLLEKYRTE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatacggaaagccgtcttccccgtcgcagggatgggaacacgcttcctgccc
gccaccaaggcaagcccgaaagaaatgctgcccatcgtcgacaagccgctgatccaatac
gccgtagaagaagccgtggaagccggctgcacggaaatggtgtttgttaccggacgcaac
aaacgcagcatcgaagaccatttcgacaaggcatacgaactcgaaaccgagttggaaatg
cgccataaagacaaattgttggaacacgtccgcaacatcctgccgccgaacattacctgc
ctctacatccgtcaggcggaagcactgggcttgggacacgccgtcttgtgcgcccgcgcc
gccatcggcgacgaaccctttgccgtgattttggctgacgatttaatcgatgcccaaaaa
ggcgcgctcaaacaaatggtcgaagtgtacgaacgcagcggcaacagcattttgggcgta
gaaactgtcgaaccgtcgcaaaccggctcatacggcatcgtcgaaaccgaacagctcaaa
cagttccaacgcattaccggcattgtcgaaaaacccaagcccgaagacgcgccctccaac
cttgccgtcgtcggacgctacatccttaccccgcgcattttcgacttactgaccggactg
ccgcgcggcgcgggcaacgaaatccagcttacagacggcatcgccaagctgctcgatcac
gaatttgtcctagcgcacccctttgaaggcacgcgctacgactgcggcagcaaactgggc
tatctggaagccaccgtcgcctacggcctgaaacaccccgaaaccggcgaacccttccgc
cgccttttggaaaaataccgtaccgaataa

DBGET integrated database retrieval system