KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1013Help
Entry
NMA1013           CDS       T00031                                 

Definition
(GenBank) hypothetical protein NMA1013
  KO
K09007  GTP cyclohydrolase IB [EC:3.5.4.16]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00790  Folate biosynthesis
nma01100  Metabolic pathways
Module
nma_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMA1013
Enzymes [BR:nma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NMA1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCHY-1 Speriolin_C
Motif
Other DBs
NCBI-ProteinID: CAM08235
UniProt: Q9JV35
Position
976927..977700
Genome map
AA seq 257 aa AA seqDB search
MNTIADVQSSRDLRNLPINQVGIKDLRFPITLQTAEGIQSTVARLTMTVYLPAEQKGTHM
SRFVALMEQHTEALDFAQLRRLTAEMVALLDSRAGKISVSFPFFRKKTAPVSGIRSLLDY
DVSLTGEMKDGAYGHSMKVMIPVTSLCPCSKEISQYGAHNQRSHVTVSLTADAEVGIEEV
IDYVEAQASCQLYGLLKRPDEKYVTEKAYENPKFVEDMVRDVATSLIADKRIKSFVVESE
NFESIHNHSAYAYIAYP
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaacactattgcagacgtgcaatccagccgagatttgcgcaatctgccgatcaatcag
gtcggtatcaaagacctgcgctttccgattaccctgcaaactgcagaaggcatccagtcc
acagttgcccgtctgaccatgacggtttacctgcctgccgagcagaagggtacgcatatg
tcgcgctttgtcgcattgatggagcaacataccgaagccttggattttgcacaattgcgc
aggctgactgctgaaatggtcgcgcttttggattcccgcgccggcaaaatcagcgtttct
ttcccatttttccgcaagaaaaccgccccggtttccggtattcggtccttactggattat
gatgtcagcctcacgggcgaaatgaaagacggtgcatacggccacagtatgaaggtcatg
attcccgtaacctcgctttgcccgtgttccaaagaaatttcccaatatggcgcgcacaac
cagcgttcgcacgttaccgtcagcctgactgccgatgccgaagtcggtatcgaggaagtc
atcgattatgtggaggcgcaggcgagctgccaactctacggcctgctcaaacgccccgat
gaaaaatacgttaccgaaaaagcctacgaaaacccgaaattcgtggaagatatggtgcgc
gatgtcgctacttcgctgattgccgacaaacgcatcaagagtttcgtcgtcgagagcgag
aatttcgagtctatccacaaccattcggcttatgcctatatcgcctacccgtag

DBGET integrated database retrieval system